New Drug Approvals

Home » APPROVALS 2022

Category Archives: APPROVALS 2022

DRUG APPROVALS BY DR ANTHONY MELVIN CRASTO .....FOR BLOG HOME CLICK HERE

Blog Stats

  • 4,966,201 hits

Flag and hits

Flag Counter

Enter your email address to follow this blog and receive notifications of new posts by email.

Join 37.8K other subscribers
Follow New Drug Approvals on WordPress.com

Archives

Categories

Recent Posts

Flag Counter

ORGANIC SPECTROSCOPY

Read all about Organic Spectroscopy on ORGANIC SPECTROSCOPY INTERNATIONAL 

Enter your email address to follow this blog and receive notifications of new posts by email.

Join 37.8K other subscribers
DR ANTHONY MELVIN CRASTO Ph.D

DR ANTHONY MELVIN CRASTO Ph.D

DR ANTHONY MELVIN CRASTO, Born in Mumbai in 1964 and graduated from Mumbai University, Completed his Ph.D from ICT, 1991,Matunga, Mumbai, India, in Organic Chemistry, The thesis topic was Synthesis of Novel Pyrethroid Analogues, Currently he is working with AFRICURE PHARMA, ROW2TECH, NIPER-G, Department of Pharmaceuticals, Ministry of Chemicals and Fertilizers, Govt. of India as ADVISOR, earlier assignment was with GLENMARK LIFE SCIENCES LTD, as CONSUlTANT, Retired from GLENMARK in Jan2022 Research Centre as Principal Scientist, Process Research (bulk actives) at Mahape, Navi Mumbai, India. Total Industry exp 32 plus yrs, Prior to joining Glenmark, he has worked with major multinationals like Hoechst Marion Roussel, now Sanofi, Searle India Ltd, now RPG lifesciences, etc. He has worked with notable scientists like Dr K Nagarajan, Dr Ralph Stapel, Prof S Seshadri, etc, He did custom synthesis for major multinationals in his career like BASF, Novartis, Sanofi, etc., He has worked in Discovery, Natural products, Bulk drugs, Generics, Intermediates, Fine chemicals, Neutraceuticals, GMP, Scaleups, etc, he is now helping millions, has 9 million plus hits on Google on all Organic chemistry websites. His friends call him Open superstar worlddrugtracker. His New Drug Approvals, Green Chemistry International, All about drugs, Eurekamoments, Organic spectroscopy international, etc in organic chemistry are some most read blogs He has hands on experience in initiation and developing novel routes for drug molecules and implementation them on commercial scale over a 32 PLUS year tenure till date Feb 2023, Around 35 plus products in his career. He has good knowledge of IPM, GMP, Regulatory aspects, he has several International patents published worldwide . He has good proficiency in Technology transfer, Spectroscopy, Stereochemistry, Synthesis, Polymorphism etc., He suffered a paralytic stroke/ Acute Transverse mylitis in Dec 2007 and is 90 %Paralysed, He is bound to a wheelchair, this seems to have injected feul in him to help chemists all around the world, he is more active than before and is pushing boundaries, He has 100 million plus hits on Google, 2.5 lakh plus connections on all networking sites, 100 Lakh plus views on dozen plus blogs, 227 countries, 7 continents, He makes himself available to all, contact him on +91 9323115463, email amcrasto@gmail.com, Twitter, @amcrasto , He lives and will die for his family, 90% paralysis cannot kill his soul., Notably he has 38 lakh plus views on New Drug Approvals Blog in 227 countries......https://newdrugapprovals.wordpress.com/ , He appreciates the help he gets from one and all, Friends, Family, Glenmark, Readers, Wellwishers, Doctors, Drug authorities, His Contacts, Physiotherapist, etc He has total of 32 International and Indian awards

Verified Services

View Full Profile →

Archives

Categories

Flag Counter

Pamiparib


Pamiparib

BGB-290 APPROVED CHINA 2022, BEIGENE

(2R)-14-fluoro-2-methyl-6,9,10,19-tetrazapentacyclo[14.2.1.02,6.08,18.012,17]nonadeca-1(18),8,12(17),13,15-pentaen-11-one

  • 1446261-44-4
  • 8375F9S90C
  • 5,6,7a,11-Tetraazacyclohepta(def)cyclopenta(a)fluoren-4(7H)-one, 2-fluoro-5,8,9,10,10a,11-hexahydro-10a-methyl-, (10aR)-
  • 5,6,7a,11-Tetraazacyclohepta[def]cyclopenta[a]fluoren-4(7H)-one, 2-fluoro-5,8,9,10,10a,11-hexahydro-10a-methyl-, (10aR)-
  • 298.31 g/mol, C16H15FN4O

Pamiparib, sold under the brand name Partruvix, is a pharmaceutical drug used for the treatment of various types of cancer. Pamiparib is a member of the PARP inhibitor drug class.[1]

In China, it is approved for the treatment of germline BRCA mutation-associated recurrent advanced ovarianfallopian tube, and primary peritoneal cancers previously treated with two or more lines of chemotherapy.[2]

It is currently under investigation for the treatment of other forms of cancer.[3][1]

Pamiparib is under investigation in clinical trial NCT03933761 (Pamiparib in Fusion Positive, Reversion Negative High Grade Serous Ovarian Cancer or Carcinosarcoma With BRCA1/2 Gene Mutations If Progression on Substrate Poly ADP Ribose Polymerase Inhibitbor (PARPI) or Chemotherapy).

Pamiparib is an orally bioavailable inhibitor of the nuclear enzyme poly(ADP-ribose) polymerase (PARP), with potential antineoplastic activity. Upon administration, pamiparib selectively binds to PARP and prevents PARP-mediated repair of single-strand DNA breaks via the base-excision repair (BER) pathway. This enhances the accumulation of DNA strand breaks, promotes genomic instability, and eventually leads to apoptosis. PARP is activated by single-strand DNA breaks and, subsequently, catalyzes post-translational ADP-ribosylation of nuclear proteins which then transduce signals to recruit other proteins to repair damaged DNA. Pamiparib may both potentiate the cytotoxicity of DNA-damaging agents and reverse tumor cell chemo- and radioresistance.

REF

https://www.thieme-connect.com/products/ejournals/abstract/10.1055/s-0040-1719372

REF

J. Med. Chem. 2020, 63, 15541−15563.

https://pubs.acs.org/doi/abs/10.1021/acs.jmedchem.0c01346

1HNMR 400, DMSO D6

PATENT

WO 2018157794

https://patents.google.com/patent/WO2018157794A1/en

(R) -2-fluoro-10a-methyl-7, 8, 9, 10, 10a, 11-hexahydro-5, 6, 7a, 11-tetraazacyclohepta [def] cyclopenta – [a] fluoren-4 (5H) -one (hereafter Compound 1) , has been disclosed as a highly selective and potent Parp1/2 inhibitor, See WO 2013/097225 A1, which is incorporated herein by reference.

Figure PCTCN2018077433-appb-000001

Step 1: Synthesis of Compound-2

Figure PCTCN2018077433-appb-000017

t-Butyl bromoacetate (51.7 Kg) was dissolved in anhydrous acetonitrile (72 Kg) . The temperature was raised to 65-75 ℃, then methyl pyrroline (22 Kg) was added. The reaction mixture was condensed after the reaction was completed, the residual acetonitrile was removed by adding THF  and then condensing. After GC showed a complete removal of acetonitrile, more THF was added and stirred. The resulting solid was filtered and collected. 44.1 Kg of off white solid Compound-2 was obtained.  1H NMR (400 MHz, DMSO-d6) δ 4.91 (s, 2H) , 4.15 (m, 2H) , 3.29 (m, 2H) , 2.46 (s, 3H) , ) , 2.14 (m, 2H) , 1.46 (s, 9H) ppm.

Step 2: Synthesis of Compound-3

Figure PCTCN2018077433-appb-000018

To a cool (-60 ℃) solution of trimethylsilyl acetyne (12.4 Kg) in THF was added a solution of n-butyl lithium in hexane (43.4 Kg) . After complete addition of n-butyl lithium solution, the resulting mixture was stirred for additional 1-2 h and then the entire solution was transferred into a suspension of Compound-2 (31 Kg) in THF cooled at -60 ℃. After transfer completion, the resulting mixture was warmed to room temperature and stirred for 1 h. The reaction was quenched with water, extracted with petroleum. The organic phase was washed with brine, dried over sodium sulfate, condensed to give 25.1 Kg of Compound-3.  1H NMR (400 MHz, DMSO-d6) δ 3.34 (d, J = 16.0 Hz, 1H) , 3.15 (m, 1H) , 2.78 (d, J = 16.0 Hz, 1H) , 2.27 (m, 1H) , 1.93 (m, 1H) , 1.68 (m, 3H) , 1.41 (s, 9H) , 1.24 (s, 3H) , 0.13 (s, 9 H) ppm.

Step 3: Synthesis of Compound-4

Figure PCTCN2018077433-appb-000019

To a cool (0-5 ℃) solution of 70.1 Kg of Compound-3 in THF was added tetrabutylammonium fluoride (13.3 Kg) in THF. After de-silylation was completed, the reaction was quenched with water, extracted with petroleum (290 Kg) and the organic phase was condensed and passed through a pad of silica gel. The filtrate was condensed to give 48 Kg of Compound-4.  1H NMR (400 MHz, DMSO-d6) δ 3.36 (d, J = 16.0 Hz, 1H) , 3.15 (m, 1H) , 2.82 (d, J = 16.0 Hz, 1H) , 2.28 (m, 1H) , 1.97 (m, 1H) , 1.70 (m, 3H) , 1.41 (s, 9H) , 1.26 (s, 3H) ppm.

Step 4: Syntheses of Compound-5

Figure PCTCN2018077433-appb-000020

A solution of Compound-4 (48 Kg) in THF was warmed to 50-60 ℃. To the above solution was added a solution of (-) -di-p-methylbenzoyl-L-tartaric acid (69.6 Kg) in THF. The resulting mixture was stirred at 50-60 ℃ 1-2 h and then gradually cooled to 0-10 ℃. The resulting salt solid was filtered and re-suspended in methyl tert-butyl ether and heated at 50-60 ℃ for 1 h. The mixture was gradually cooled to 0-5 ℃. The resulting solid was filtered to give 13.1 Kg of off-white solid. The solid was treated with aqueous sodium hydroxide, extracted with petroleum, condensed to give 13.1 Kg of Compound-5 (ee≥96%) .  1H NMR (400 MHz, DMSO-d6) δ 3.36 (d, J = 16.0 Hz, 1H) , 3.15 (m, 1H) , 2.82 (d, J = 16.0 Hz, 1H) , 2.29 (m, 1H) , 1.97 (m, 1H) , 1.70 (m, 3H) , 1.41 (s, 9H) , 1.26 (s, 3H) ppm.

Step 5: Syntheses of Compound-6

Figure PCTCN2018077433-appb-000021

Intermediate B (14 Kg) , bis (triphenyl) palladium dichloride (0.7 Kg) , CuI (0.42 Kg) and tetramethyl guanidine (11.5 Kg) were dissolved in DMF (48.1 Kg) . The resulting solution was stirred and de-gassed and then heated under nitrogen. A solution of Compound-5 (9.24 Kg) in DMF (16 Kg) was added dropwise. After coupling, the organic phase was condensed, the resiue was stirred with water (145 Kg) and methyl t-butyl ether (104 Kg) , the entire mixture passed trough a pad of celite, separated. The organic phase was washed with a solution of thiourea (14 Kg) in water (165 kg) and brine (100 Kg) , condensed. The residue was dissolved in a mixture of n-heptane (120 Kg) and ethyl acetate (28 Kg) . The solution was mixed with charcoal (1.4 kg) , heated at 40-50 ℃ for 1-2 h, fltered though a pad of silica gel. The filtrate was condensed to give Compound-6 solid (14.89 Kg) and the liquid filtrate (13 Kg heptane solution, contains 1.24 Kg of Compound-6) .  1H NMR (400 MHz, DMSO-d6) δ 7.85 (d, J = 9.6 Hz, 1H) , 7.55 (m, 3H) , 7.32 (m, 2H) , 3.87 (s, 3H) , 3.37 (d, J = 16.0 Hz, 1H) , 3.22 (m , 1H) , 2.94 (d, J = 16.0, Hz, 1H) , 2.60 (m, 1H) , 2.48 (m, 1H) , 2.29 (s, 3h) , 2.26 (m, 1 H) , 1.82 (m, 2H) , 1.49 (s, 3H) , 1.43 (s, 9H) ppm.

Step 6: Syntheses of Compound-7

Figure PCTCN2018077433-appb-000022

The above heptane solution of Compound-6 was added into a cold trifluoromethane sulfonic acid (66.1 Kg) while maintaining the internal temperature below 25 ℃. Then solid Compound-6 (14.87 Kg) was added batchwise. After complete addition of Compound-6, the reaction mixture was warmed to 25-30℃ and stiired until the reaction was completed. The entire mixture was poured into a solution of sodium acetate (123.5 Kg) in water (240 Kg) . pH of the solution was then adjusted to 7-8 by adding solid potassium carbonate (46.1 Kg) . The mixture was extracted wuth dichloromethane (509 Kg) , condensed. The residue was mixed with n-heptane (41 Kg) , condensed again to give the precipitate which was filtered and washed by n-heptane (8 Kg) and dried. 8.78 Kg of Compound-7 was obtained.  1H NMR (400 MHz, DMSO-d6) δ 12.30 (s, 1H) , 7.35 (dd, J = 9.2, 1.6 Hz, 1H) , 7.08 (dd, J = 9.2, 1.6 Hz, 1H) , 3.79 (s, 3H) , 3.68 (d, J = 17.2 Hz, 1H) , 3.21 (d, J = 17.2 Hz, 1H) , 3.06 (m, 1H) , 2.68 (m, 1H) , 1.96 (m, 1H) , 1.74 (m, 1H) , 1.49 (s, 3H) ppm.

Step 7: Syntheses of Compound 1 –Crude 1

Figure PCTCN2018077433-appb-000023

Compound-7 (8.76 Kg) was dissolved in methanol (69 Kg) and internally cooled below 25 ℃. Acetic acid (9.3 Kg) and hydrazine hydrate (7.4 Kg, 85%) were added while maintaining internal temperature below 25 ℃. After de-gassed and re-filled with nitrogen (repeated three times) , the reaction mixture was stirred at 55-60 ℃ for 4 h. After a complete reaction, the mixture was mixed with water (29 Kg) . The organic phase was condensed and potassium carbonate (12.5 Kg) in water (40 Kg) was added. The resulting solid was filtered, washed with water (18.3 Kg) . The solid was slurred with water (110 Kg) , centrifuged, dried and slurred with ethanol (9.4 Kg) , centrifuged, filtered, washed with ethanol, dried in vacuum to give Compound 1-Crude 1 (7.91 Kg) .  1H-NMR (600 MHz, DMSO-d 6) δ 12.0 (s, 1H) , 10.2 (s, 1H) , 7.31 (dd, 1H, J=9.6, 2.0 Hz) , 7.19 (dd, 1H, J=9.6, 2.0 Hz) , 3.77 (d, 1H, J=16.4 Hz) , 3.34 (d, 1H, J=16.4 Hz) , 2.97-3.02 (m, 1H) , 2.54-2.58 (m, 1H) , 2.35-2.40 (m, 1H) , 1.90-1.94 (m, 1H) , 1.73-1.75 (m, 1H) , 1.47 (s, 3H) , 1.43-1.45 (m, 1H) ppm. MS (ESI) m/e [M+1]  + 299.

Step 8: Synthesis of Compound 1-Crude 2

Figure PCTCN2018077433-appb-000024

Under nitrogen protection, Compound 1 (Crude 1) (7.88 Kg) was stirred with isopropanol (422 Kg) and heated at 70-80 ℃ for 1-2 h until the solid disappeared completely. A solution of (+) -di-p-methylbenzoyl-D-tartaric acid (10.25 Kg) in isopropanol (84.4 Kg) was added. The mixture was stirred for 14-16 h, filtered and washed with isopropanol (16 Kg) , dried. The resulting salt was added into a stirred solution of potassium carbonate (6.15 Kg) in water (118 Kg) . The precipitate was centrifuged, filtered, washed with water (18 Kg) . The solid was slurred with water (110 Kg) , centrifuged, dried. The solid was dissolved in THF (75 Kg) , active carbon (0.8 Kg) was added. The mixture was degassed and re-protected by nitrogen, stirred and heated at 40-45 ℃ for 1-2 h, cooled, filtered through celite, condensed to give the solid which was further slurred with ethanol (6.5 Kg) , filtered to give 5.6 Kg of Compound

 1 crude

 2.  1H NMR (400 MHz, DMSO-d6) δ 12.0 (s, 1H) , 10.2 (s, 1H) , 7.31 (dd, 1H, J=9.6, 2.0 Hz) , 7.19 (dd, 1H, J=9.6, 2.0 Hz) , 3.77 (d, 1H, J=16.4 Hz) , 3.34 (d, 1H, J=16.4 Hz) , 2.97-3.02 (m, 1H) , 2.54-2.58 (m, 1H) , 2.35-2.40 (m, 1H) , 1.90-1.94 (m, 1H) , 1.73-1.75 (m, 1H) , 1.47 (s, 3H) , 1.43-1.45 (m, 1H) ppm. MS (ESI) m/e [M+1]  + 299.

PATENT

WO 2017032289

https://patents.google.com/patent/WO2017032289A1/en

Scheme 1: Synthetic Process of Compound A in a large scale

Figure PCTCN2016096200-appb-000008

PATENT

WO 2013097225

https://patents.google.com/patent/WO2013097225A1/en

Example 36: Synthesis of Compound 69 Compound 69: (RV2-fluoro-10a-methyl-7,8,9 JO .10a.l l-hexahydro-5,6,7a,l 1- tetraazacvcloheptardeflcyclopentara1fluoren-4(5H)-one

Figure imgf000072_0001

Step 1 : Methyl 2-bromo-5-fluoro-3-(2,2,2-trifluoroacetamido)benzoate

Figure imgf000072_0002

To a solution of methyl 3-amino-2-bromo-5-fluorobenzoate (25. Og, 100 mmol) and K2CO3 (42.0g, 302 mmol) in DCM (250mL) were added 2,2,2-trifluoroacetic anhydride (249.0g, 1.197mol) at 5 -10°C under nitrogen atmosphere. The mixture was stirred for overnight at 25°C. The reaction mixture was diluted with DCM, washed with H20 (200mLx2) and saturared

NaHCC”3 aq (200mLx2), dried over anhydrousNa2S04, and concentrated to give 34.0 g (98%) of methyl 2-bromo-5-fluoro-3-(2,2,2-trifluoroacetamido)benzoate as white solid. 1H NMR (CDCI3– dl) δ 8.87 (s, 1H), 8.36 (d, 1H,J=6.4 Hz), 7.43 (d, 1H,J=5.2 Hz), 3.98 (s, 3H).

Step 2: (R)-benzyl 2-((4-fluoro-2-(methoxycarbonyl)-6- (2,2,2trifluoroacetamido)phenyl)ethvnyl)-2-methylpyrrolidine-l-carboxylate

Figure imgf000072_0003

A mixture of methyl 2-bromo-5-fluoro-3-(2,2,2-trifluoroacetamido)benzoate (27.52g, 80 mmol), (PPh3)2PdCl2 (2.8 g, 4 mmol), (R)-benzyl 2-ethynyl-2-methylpyrrolidine-l-carboxylate (19.44 g, 80 mmol),copper(I) iodide (764 mg, 4 mmol) and tetramethylguanidine (27.6 g, 240 mmol) in DMF (200 mL) was heated at 80 °C with nitrogen protection system for 16 hours. The cooled reaction mixture was diluted with EA (3×200 mL) and water (800 mL). The organic layer was separated, washed with water (2×200 mL), dried (Na2S04), and concentrated. The remaining residue was chromatographed on silica gel, eluted with gradient 0-30% EtOAc in hexane to give the product (R)-benzyl 2-((4-fluoro-2-(methoxycarbonyl)-6-

(2,2,2trifluoroacetamido)phenyl)ethynyl)-2-methylpyrrolidine-l-carboxylate (21 g, 53%) as white solid. 1H NMR (DMSO-dl) δ 11.01 (s, 1H), 7.64-7.77 (m, 1H), 7.36 (m, 5H),7.19-7.31 (m, 1H), 5.04-5.12 (m, 2H), 3.85(s, 3H ), 3.44-3.47 (m, 2H), 2.0-2.29 (m, 2H), 1.90-1.97 (m, 2H), and 1.69 (s, 3H).MS (ESI) m/e [M+l]+ 507.0.

Step 3: (R)-methyl 6-fluoro-2-(2 -methyl- l-(2,2,2-trifluoroacetyl)pyrrolidin-2-yl)-lH-indole-4- carboxylate

Figure imgf000073_0001

To a solution of (R)-benzyl 2-((4-fluoro-2-(methoxycarbonyl)-6- (2,2,2trifiuoroacetamido)phenyl)ethynyl)-2-methylpyrrolidine- 1 -carboxylate(5.0g, 1 Ommol) in toluene was added zinc(II) bromide(l 1.25g, 50 mmol) at room temperture. The reaction mixture was heated at 80 °C with nitrogen protection system for 15 hours. The solvent was removed under reduced pressure, and the residue was treated with DCM (500 mL) and water (800 mL). The organic layer was separated, washed with water (2×200 mL), dried (Na2S04), and

concentrated. The remaining residue was chromatographed on silica gel ,eluted with gradient 0- 50% EtOAc in hexane to give the product(R)-methyl 6-fluoro-2-(2 -methyl- 1 -(2,2,2- trifluoroacetyl)pyrrolidin-2-yl)-lH-indole-4-carboxylate (1.9 g, 51%) as yellow solid. 1H NMR (CDCls-dl) δ 9.97 (s, 1H), 7.62 (d,lH, J=10.2 Hz), 7.27 (d,lH, J=9.6 Hz), 7.05 (d,lH, J=1.2 Hz), 3.98 (s, 3H), 3.86-3.88 (m,2H),2.91-2.96 (m,lH), 2.25-2.28 (m,lH), 2.12-2.16 (m, 2H), and 1.99 (s, 3H). MS (ESI) m/e [M+l]+ 507.0.

Step 4: (R)-methyl 6-fluoro-2-(2-methylpyrrolidin-2-yl)-lH-indole-4-carboxylate

Figure imgf000073_0002

To a solution of (R)-methyl 6-fluoro-2-(2 -methyl- l-(2,2,2-trifluoroacetyl)pyrrolidin-2-yl)- lH-indole-4-carboxylate (1.0 g, 1.9 mmol) in MeOH was added NaBH4 (706 mg, 11.4 mmol) at room temperature. The reaction mixture was refluxed for 4 hours with nitrogen protection system. The solvent was removed under reduced pressure. The residue was dissolved in DCM (200 mL), which was washed with water (200 mL)and brine (200 mL), dried over Na2S04, and concentrated to give the desire product as yellow oil. (R)-methyl 6-fluoro-2-(2-methylpyrrolidin- 2-yl)-lH-indole-4-carboxylate (727 mg, 98%). 1H NMR (CD3OD-dl) δ 7.50(dd,lH, J=10.2, 2.4 Hz), 7.32 (d,lH, J=9.0, 2.4 Hz), 6.93 (s, 1H),3.97 (s, 3H), 3.03-3.12 (m, 2H), 2.27-2.32 (m, 1H),1.88-1.98 (m, 3H), and 1.60 (s, 3H). MS (ESI) m/e [M+l]+ 276.0.

Step 5: (R)-Methyl 6-fluoro-2-(l-(2-methoxy-2-oxoethyl)-2-methylpyrrolidin-2-yl)-lH-indole-4- carboxylate

Figure imgf000074_0001

To a stirred mixture of (R)-methyl 6-fluoro-2-(2-methylpyrrolidin-2-yl)-lH-indole-4- carboxylate (1.0, 1.27 mol), CH3CN (50 ml) and methylbromoacetate (0.58 g, 3.82mmol) was added DIPEA(0.82 g, 6.35 mmol). The reaction mixture was stirred at room temperature for about 20 hours. The reaction mixture was then diluted with CH2CI2 (15 ml) and washed with water three times. The organic layer was dried with MgS04 and concentrated to give 0.85 g of (R)-methyl 6-fluoro-2-(l-(2-methoxy-2-oxoethyl)-2-methylpyrrolidin-2-yl)-lH-indole-4- carboxylate. 1H NMR (CD3OD-d4) δ 7.47 (dd, 1H, J=2.4, 12.0 Hz), 7.27 (dd, 1H, J=2.4, 9.0 Hz), 6.89 (s,lH), 3.95 (s, 3H), 3.66-3.68 (m, 1H), 3.64 (s, 3H), 3.16-3.17 (m, 2H), 2.72-2.75 (m, 1H), 1.88-2.02 (m, 4H), and 1.44 (s, 3H).MS (ESI) m/e [M+l]+ 349.0.

Step 6: (R)-methyl 9-fluoro-l lb-methyl-6-oxo-2,3, 5,6, 11,1 lb-hexahydro-lH-indolizinor8,7- blindole-7-carboxylate

Figure imgf000074_0002

In a 25 -mL flask, (R)-methyl 6-fluoro-2-(l-(2-methoxy-2-oxoethyl)-2-methylpyrrolidin-2- yl)-lH-indole-4-carboxylate (100 mg) was treated with anhydrous MeS03H (6 mL). The flask was fitted with a reflux condenser and heated at 60 °C for 1 h. Then, the reaction mixture was cooled in an ice-bath and diluted with distilled water (6.0 mL). The pH of the solution was increased to pH~10 by the addition of saturated aq. NaHC03. The reaction mixture was then extracted with EtOAc (3×5 mL). Theorganic extracts were combined and washed with brine (lx5mL), dried over Na2S04, filtered, and concentrated. The residue was purified by Pre-TLC to give (R)-methyl 9-fluoro-l lb-methyl-6-oxo-2,3, 5,6,11,1 lb-hexahydro-lH-indolizino[8,7- b]indole-7-carboxylate(30 mg). 1H NMR (CDCl3-d) δ 7.14-7.224 (m, 2H), 4.03 (s, 3H), 3.81- 3.84 (m, 1H), 3.57-3.59 (m, 1H), 3.22-3.24 (m, 1H), 2.92-2.94 (m, 1H), 2.39-2.40 (m,lH), 2.16- 2.17 (m,lH),1.93-1.94 (m, 1H), 1.63 (s, 3H), and 1.56-1.57 (m, 1H).MS (ESI) m e [M+l]+ 317.0. Step 7: (RV2-fluoro-10a-methyl-7,8,9 JO JOa.l l-hexahvdro-5.6.7a.l 1- tetraazacyclohepta[def|cyclopenta[alfluoren-4(5H)-one

Figure imgf000075_0001

A solution of compound (R)-methyl 9-fluoro-l lb-methyl-6-oxo-2,3,5,6,l 1,1 lb-hexahydro- lH-indolizino[8,7-b]indole-7-carboxylate (90 mg), acetic acid (0.54 g), and hydrazine hydrate (0.28g) in methanol (30 mL) was heated at reflux. After 5 h, the reaction was cooled and water (5 mL) was added.The mixture was extracted with EtOAc (3×5 mL). The combined organic layers were washed with brine (10 mL) and driedover MgSC^. The mixture was filtered, and the filtrate was evaporated to dryness, and the residue was purified by Pre-TLC using CH2CI2 as eluent to give 80 mg of (R)-2-fluoro-10a-methyl-7,8,9,10,10a,l l-hexahydro-5,6,7a,l l- tetraazacyclohepta[defJcyclopenta[a]fluoren-4(5H)-one. 1H NMR (DMSO-d6) δ 11.9 (s, 1H), 10.2 (s, 1H), 7.30 (d, 1H, J=9.6 Hz), 7.20 (d, 1H, J=10.2 Hz), 3.76 (d, 1H, J=16.4 Hz), 3.34 (d, 1H, J=16.4 Hz), 2.99-3.02 (m, 1H), 2.54-2.58 (m, 1H), 2.35-2.40 (m, 1H), 1.90-1.94 (m, 1H), 1.73-1.75 (m, 1H), 1.48 (s, 3H), and 1.43-1.45(m, 1H). MS (ESI) m/e [M+l]+ 299.

SYN

https://doi.org/10.1021/acs.jmedchem.3c02374
J. Med. Chem. 2024, 67, 4376−4418

Pamiparib (Partruvix). Pamiparib (27) is an orally active, potent, and highly selective PARP1 and PARP2
inhibitor being developed by BeiGene Limited.190 The drug was approved in China in 2022 for the treatment of germline BRCA-mutated recurrent advanced ovarian, fallopian tube, or primary peritoneal cancer.190BRCA1 and BRCA2 are critical tumor suppressors that help DNA double-strand break (DSB)
repair by functional homologous recombination (HR). 191,192 192 It was claimed that pamiparib showed good brain penetration ability for the treatment of cancer patients with brain metastasis. A small-scale synthesis of pamiparib (27) was first disclosed by BeiGene Limited in 2013.193 Later, they reported a
modified route for industrial scale preparation of the API which is described below. 194,195
The synthesis commenced with 2-bromo-5-fluorobenzoic acid (27.1) which was subjected to nitration followed by esterification to deliver methyl benzoate 27.2 in 42% overall yield (Scheme 49). The nitro
derivative 27.2 was reduced to an aniline and subsequently protected as a tosylate to obtain the key aryl bromide fragment 27.3. It should be noted that a yield for the tosylation step was not provided by the inventors.
Preparation of the other key fragment 27.10 and endgame of the pamiparib synthesis are described in Scheme 50. First,pyrroline 27.4 was treated with t-butyl bromoacetate 27.5 to generate iminium bromide salt 27.6. An acetylide derived from trimethylsilyl acetylene 27.7 was then added to the iminium to
install the tertiary center. A TBAF-mediated removal of the silyl moiety delivered racemic alkyne 27.8 in 69% yield over two steps. The enantiomers were separated via a classical salt resolution with (−)-di-p-methylbenzolyl-L-tartaric acid (27.9). The desired (R)-enantiomer 27.10 was obtained in 96%
enantiomeric excess (ee) after isolation as the free-base amine. The authors explored several routes to access 27.10; however,the salt resolution approach was selected due to its scalability and reproducibility.
192With the alkyne subunit 27.10 and bromide subunit 27.3 in hand, the next objective was combining them in a convergent manner. This was achieved via an efficient Larock heteroannulation reaction, affording indole 27.11 in 85% yield. Treatment of diester 27.11 with triflic acid triggered removal of both t-butyl ester and N-tosyl protecting groups, as well as cyclization to generate tetracycle 27.12 in 94% yield. The ketoester 27.12 was subjected to hydrazine hydrate in the presence of acetic acid to deliver the
crude cyclized material which was purified via salt formation with (+)-DTTA. Finally, treatment of the amine precursor with water in hot isopropanol delivered pamiparib (27) as a sesquihydrate crystalline solid in 50% over 3 steps.

(190) Markham, A. Pamiparib: First approval. Drugs 2021, 81,1343−1348.
(191) Xiong, Y.; Guo, Y.; Liu, Y.; Wang, H.; Gong, W.; Liu, Y.;Wang, X.; Gao, Y.; Yu, F.; Su, D.; et al. Pamiparib is a potent andselective PARP inhibitor with unique potential for the treatment of brain tumor. Neoplasia 2020, 22, 431−440.
(192) Wang, H.; Ren, B.; Liu, Y.; Jiang, B.; Guo, Y.; Wei, M.; Luo,L.; Kuang, X.; Qiu, M.; Lv, L.; et al. Discovery of pamiparib (BGB290), a potent and selective poly (ADP-ribose) polymerase (PARP)inhibitor in clinical development. J. Med. Chem. 2020, 63, 15541−15563.

(193) Zhou, C.; Ren, B.; Wang, H. Fused tetracyclic and pentacyclic
dihydrodiazepinocarbazolones as PARP inhibitors and their prepara
tion. WO 2013097225 A1, 2013.

(194) Wang, H.; Zhou, C.; Ren, B.; Kuang, X. Process for preparing
(R)-2-fluoro-10a-methyl-7,8,9,10,10a,11-hexahydro-5,6,7a,11
tetraazacyclohepta[def]cyclopenta[a]fluoren-4(5H)-one as PARP in
hibitor, crystalline forms, and uses thereof. WO 2017032289 A1,
2017.
(195) Wang, H.; Kuang, X.; Zhou, C. Crystalline forms of salts of
fused tetra or penta-cyclic dihydrodiazepinocarazolones, and uses
thereof. WO 2018157794 A1, 2018.

str1

AS ON JUNE2025 4.45 LAKHS VIEWS ON BLOG WORLDREACH AVAILABLEFOR YOUR ADVERTISEMENT

wdt-16

join me on Linkedin

Anthony Melvin Crasto Ph.D – India | LinkedIn

join me on Researchgate

RESEARCHGATE

This image has an empty alt attribute; its file name is research.jpg

join me on Facebook

Anthony Melvin Crasto Dr. | Facebook

join me on twitter

Anthony Melvin Crasto Dr. | twitter

+919321316780 call whatsaapp

EMAIL. amcrasto@gmail.com

……

References

  1.  Xiong Y, Guo Y, Liu Y, Wang H, Gong W, Liu Y, et al. (September 2020). “Pamiparib is a potent and selective PARP inhibitor with unique potential for the treatment of brain tumor”Neoplasia22 (9): 431–440. doi:10.1016/j.neo.2020.06.009PMC 7350150PMID 32652442.
  2.  Markham A (July 2021). “Pamiparib: First Approval”. Drugs81 (11): 1343–1348. doi:10.1007/s40265-021-01552-8PMID 34287805.
  3.  Friedlander M, Mileshkin L, Lombard J, Frentzas S, Gao B, Wilson M, et al. (September 2023). “Pamiparib in combination with tislelizumab in patients with advanced solid tumours: results from the dose-expansion stage of a multicentre, open-label, phase I trial”British Journal of Cancer129 (5): 797–810. doi:10.1038/s41416-023-02349-0PMC 10449784PMID 37474720.
Clinical data
Trade namesPartruvix
Other namesBGB-290
ATC codeL01XK06 (WHO)
Legal status
Legal statusUS: Investigational New DrugRx in China
Identifiers
IUPAC name
CAS Number1446261-44-4
PubChem CID135565554
DrugBankDB14769
ChemSpider58805610
UNII8375F9S90C
KEGGD11426
ChEMBLChEMBL4112930
Chemical and physical data
FormulaC16H15FN4O
Molar mass298.321 g·mol−1
3D model (JSmol)Interactive image
SMILES
InChI

/////////////Pamiparib, APPROVALS 2022, CHINA 2022, BeiGene, BGB 290

Dorzagliatin


Dorzagliatin

  • CAS 1191995-00-2
  • HMS5552
  • Sinogliatin
  • HMS-5552
  • MW 462.9 g/mol MF C22H27ClN4O5
  • (2S)-2-[3-(2-chlorophenoxy)-5-oxo-2H-pyrrol-1-yl]-N-[1-[(2R)-2,3-dihydroxypropyl]pyrazol-3-yl]-4-methylpentanamide
  • RO5305552
  • RO-5305552
  • X59W6980E8

Dorzagliatin(18)was developed by Hua Medicine as a treatment for diabetic kidney disease(DKD), type1diabetes mellitus(T1DM), and type2 diabetes mellitus (T2DM). CHINA 2022

Dorzagliatin is a glucokinase activator that is being developed to treat diabetes.[1] Unlike other diabetes drugs, it is intended to increase insulin sensitivity.[2]

Dorzagliatin is under investigation in clinical trial NCT03173391 (Long-term Efficacy and Safety of HMS5552 in T2DM).

PATENT

https://patents.google.com/patent/CN112062754A/en

(R) -1- ((2, 2-dimethyl-1, 3-dioxolane-4-yl) methyl) -1H-pyrazole-3-ammonia (II) is a very important medical intermediate for synthesizing Dorzagliatin. Dorzagliatin is a novel medicine for treating type 2 diabetes mellitus, and (R) -1- ((2, 2-dimethyl-1, 3-dioxolane-4-yl) methyl) -1H-pyrazole-3-ammonia (II) is an essential intermediate in the synthetic process of the medicine, and along with the steady promotion of new Dorzagliatin medicines to the market, the demand of the chiral intermediate in the market is required to be rapidly increased.

The main production method of the key chiral intermediate is shown as follows: reducing nitro in 3-nitro-1H-pyrazole substrate into amino, protecting free amino, carrying out N-alkylation reaction with (R) – (-) -2, 3-O-isopropylidene glycerol-OH derivative active intermediate, and deprotecting to obtain the final product. The synthetic route needs to be subjected to an N-protection process, so that route steps are added, and the cost is increased. The synthesis of N-protected substrate iv is reported: in the patent US2013203802, 1H-pyrazole-3-ammonia is protected by acetic anhydride, and in WO2017040757, N-acetyl-1H-pyrazole-3-ammonia is obtained by an N- (1-benzyl-1H-pyrazole-3-yl) acetamide debenzylation method; the protection of the N-benzoyl group of 1H-pyrazol-3-amine is reported in the patent US 6118008; in addition, WO2009106209, US2012095064, mention the phthalimide protection strategy of 1H-pyrazole-3-ammonia with phthalic anhydride.

Example 1

Preparation of (R) -1- ((2, 2-dimethyl-1, 3-dioxolan-4-yl) methyl) -1H-pyrazol-3-amine

The first step is as follows: intermediate (R) -I preparation:

under the protection of nitrogen, 3-nitro-1H-pyrazole (1) (100.00g,0.884mol), ethanol (1.0L) and sodium carbonate (133.90g, 1.26mol) are sequentially added into a 3L reaction bottle, and the system is stirred for 0.5H at room temperature; (S) – (-) -4-chloromethyl-2, 2-dimethyl-1, 3-dioxolane ((S) -2) (126.84g, 0.842mol) was dissolved and diluted with 634ml of ethanol and then added dropwise to the reaction flask. After the dropwise addition, the temperature is raised to 50 ℃ and the reaction is stirred for 5 hours. Ethanol was distilled off under reduced pressure, and the residue was diluted with (1.0L) of water and then extracted twice with dichloromethane (500ml × 2); the organic phase was washed with water and then with saturated sodium chloride brine. Concentrating under reduced pressure to remove dichloromethane to obtain crude oily substance; the crude product was purified by silica gel column chromatography (eluent: n-hexane/ethyl acetate mixed system) to give 166.5g of a pale yellow oily product, with a yield of 87% and an ee value of 98% or more.

The second step is that: reducing nitro to obtain target product

A2L autoclave was charged with (R) -I substrate (150g, 0.66mol), methanol (750mL), Pd/C (0.75g, 0.5% W/W), and the mixture was subjected to nitrogen substitution three times, then hydrogen substitution three times, under a hydrogen-charging pressure of 2.0MPa, at a temperature of 50 ℃ for reaction for 8 hours. Filtering, filtering to remove Pd/C catalyst, concentrating the filtrate to remove methanol to obtain 123.70g of light yellow oily matter, wherein the yield is 95%, and the ee value is more than or equal to 98%.

Example 2

Preparation of (R) -1- ((2, 2-dimethyl-1, 3-dioxolan-4-yl) methyl) -1H-pyrazol-3-amine by Raney-Ni reduction system

The first step is the same as in example 1.

The second step is that: reduction of nitro groups by Rany-Ni

The intermediate (R) -I (150g, 0.66mol) obtained in the first step was charged into a 2L reactor, and ethanol (1.2L) was added thereto and stirred, followed by adding Rany-Ni (75g) and stirring at room temperature for reaction for 15 hours. Filtering, filtering to remove the solid catalyst, and concentrating the filtrate to dryness to obtain 106.77g of light yellow oily substance with yield of 82% and ee value of more than or equal to 97%.

Example 3

Preparation of (R) -1- ((2, 2-dimethyl-1, 3-dioxolan-4-yl) methyl) -1H-pyrazol-3-amine by hydrazine hydrate system

The first step is the same as in example 1.

The second step is that: A2L reaction flask was charged with intermediate (R) -I (150g, 0.66mol), ferric trichloride (528mg, 3.3mmol), and ethanol (1.2L), stirred, charged with hydrazine hydrate (39.5g, 0.79mol), and heated to reflux for 6 h. Ethanol was removed by concentration under reduced pressure, the residue was diluted with 750ml of water and extracted twice with ethyl acetate (250 ml. times.2). The organic phase was washed with water and then with saturated brine. The ethyl acetate is removed by concentration to obtain 110.7g of crude light yellow oily substance, the yield is 85 percent, and the ee value is more than or equal to 97 percent.

SYN

https://doi.org/10.1021/acs.jmedchem.3c02374J.Med.Chem.2024,67,4376−4418

Dorzagliatin(HuaTangNing).

Dorzagliatin(18)was developed by Hua Medicine as a treatment for diabetic kidney disease(DKD), type1diabetes mellitus(T1DM), and type2 diabetes mellitus (T2DM).133 This first-in-class, small
molecule,oral,glucokinaseactivator(GKA)wasfirst approved in ChinainSeptember2022foradultpatientswithT2DMasa monotherapy and in combination with metformin (an antidiabetic medication).134 Expression of glucokinase is reduced for individuals with T2DM, thus GKAs such as dorzagliatin serve as a novel class of antidiabetic treatment options.135,136 Theinitialpatent thatdisclosesthesynthesisofdorzagliatin (18)began fromreadily availablematerials 3-aminopyrazole
(18.1) and 2-chlorophenol (18.5). The synthetic strategy reliedonaconvergentamidecouplingofamine18.4(Scheme32) and carboxylic acid 18.9 (Scheme 33).137 A later disclosure provided an updated route toward amine 18.4 (Scheme 32), detailing the synthetic improvements with respect to yield and purity.138 This later disclosure also detailed the synthesis of dorzagliatinonmultikilogramscale fromtheamidationofacid18.9withamine18.4,yieldingover
10kgoftheactivepharmaceutical ingredient.Acetylationof3 aminopyrazole (18.1) with acetic anhydride provided the protectedpyrazole18.2(Scheme32). Subsequent alkylation with alkyl chloride 18.3 followed by base-mediated deprotectionyieldedamine18.4. The synthesis of acid 18.9 began with base-mediated
alkenylationof2-chlorophenol (18.5)withethyl 2-butynoate toprovideester18.6(Scheme33). Subsequentbromination withNBSandAIBNyieldsallylbromide18.7.Next,subjection
ofL-leucinemethylesterhydrochloride(18.8)tobaseresulted ina freeamine thatunderwent allylationwithbromide18.7. Acid 18.9was subsequently generated froma cyclization
condensation sequence and saponification reaction with NaOH. Final amidebondformationwas facilitatedbyEDCI andHOBt toprovideamide18.10, anddorzagliatin(18)was generatedonthemultikilogramscale followingacid-mediated acetonidedeprotectiontoreveal the1,2-diol.

(133) Syed, Y. Y. Dorzagliatin: First approval. Drugs 2022, 82,
1745−1750.
(134) Xu, H.; Sheng, L.; Chen, W.; Yuan, F.; Yang, M.; Li, H.; Li, X.;
Choi, J.; Zhao, G.; Hu, T.; et al. Safety, tolerability, pharmacokinetics,
and pharmacodynamics of novel glucokinase activator HMS5552:
results from a first-in-human single ascending dose study. Drug Des.
Devel. Ther. 2016, 10, 1619−26.
(135) Ren, Y.; Li, L.; Wan, L.; Huang, Y.; Cao, S. Glucokinase as an
emerging anti-diabetes target and recent progress in the development
of its agonists. J. Enzyme Inhib. Med. Chem. 2022, 37, 606−615.
(136) Toulis, K. A.; Nirantharakumar, K.; Pourzitaki, C.; Barnett, A.
H.; Tahrani, A. A. Glucokinase activators for type 2 diabetes:
Challenges and future developments. Drugs 2020, 80, 467−475.
(137) Berthel, S. J.; Brinkman, J. A.; Hayden, S.; Haynes, N.-E.;
Kester, R. F.; McDermott, L. A.; Qian, Y.; Sarabu, R.; Scott, N. R.;
Tilley, J. W. Pyrrolidinone as glucokinase activators and their
preparation, pharmaceutical compositions and use in the treatment
of metabolic disorders. WO 2009127546, 2009.
(138) Chen, J.; Ren, Y.; She, J.; Wang, L. Process for the preparation
of 1-([1,3]dioxolan-4-ylmethyl)-1h-pyrazol-3-ylamine. U.S. Patent US
20150315176, 2015.

str1

AS ON JUNE2025 4.45 LAKHS VIEWS ON BLOG WORLDREACH AVAILABLEFOR YOUR ADVERTISEMENT

wdt-16

join me on Linkedin

Anthony Melvin Crasto Ph.D – India | LinkedIn

join me on Researchgate

RESEARCHGATE

This image has an empty alt attribute; its file name is research.jpg

join me on Facebook

Anthony Melvin Crasto Dr. | Facebook

join me on twitter

Anthony Melvin Crasto Dr. | twitter

+919321316780 call whatsaapp

EMAIL. amcrasto@gmail.com

……

References

  1.  Chow, Elaine; Wang, Ke; Lim, Cadmon K.P.; Tsoi, Sandra T.F.; Fan, Baoqi; Poon, Emily; Luk, Andrea O.Y.; Ma, Ronald C.W.; Ferrannini, Ele; Mari, Andrea; Chen, Li; Chan, Juliana C.N. (1 February 2023). “Dorzagliatin, a Dual-Acting Glucokinase Activator, Increases Insulin Secretion and Glucose Sensitivity in Glucokinase Maturity-Onset Diabetes of the Young and Recent-Onset Type 2 Diabetes”Diabetes72 (2): 299–308. doi:10.2337/db22-0708PMC 9871194.
  2.  Zhu, Dalong; Li, Xiaoying; Ma, Jianhua; Zeng, Jiao’e; Gan, Shenglian; Dong, Xiaolin; Yang, Jing; Lin, Xiaohong; Cai, Hanqing; Song, Weihong; Li, Xuefeng; Zhang, Keqin; Zhang, Qiu; Lu, Yibing; Bu, Ruifang; Shao, Huige; Wang, Guixia; Yuan, Guoyue; Ran, Xingwu; Liao, Lin; Zhao, Wenjuan; Li, Ping; Sun, Li; Shi, Lixin; Jiang, Zhaoshun; Xue, Yaoming; Jiang, Hongwei; Li, Quanmin; Li, Zongbao; Fu, Maoxiong; Liang, Zerong; Guo, Lian; Liu, Ming; Xu, Chun; Li, Wenhui; Yu, Xuefeng; Qin, Guijun; Yang, Zhou; Su, Benli; Zeng, Longyi; Geng, Houfa; Shi, Yongquan; Zhao, Yu; Zhang, Yi; Yang, Wenying; Chen, Li (May 2022). “Dorzagliatin in drug-naïve patients with type 2 diabetes: a randomized, double-blind, placebo-controlled phase 3 trial”Nature Medicine28 (5): 965–973.

//////////Dorzagliatin, APPROVALS 22, CHINA 22, DIABETES, Hua Medicine, 1191995-00-2, HMS 5552, Sinogliatin, HMS-5552, RO 5305552, RO-5305552, X59W6980E8

Hetrombopag Olamine


Hetrombopag Olamine, RAFUTROMBOPAG OLAMINE

  • Hetrombopag diolamine
  • SHR8735 olamine
  • Hetrombopag ethanolamine
  • SHR-8735 olamine

  • 580.6 g/mol, C29H36N6O7, V45T2I862X

2-aminoethanol;5-[2-hydroxy-3-[[5-methyl-3-oxo-2-(5,6,7,8-tetrahydronaphthalen-2-yl)-1H-pyrazol-4-yl]diazenyl]phenyl]furan-2-carboxylic acid

(Z)-5-(2-Hydroxy-3-(2- (3-methyl-5-oxo-1-(5,6,7,8-tetrahydronaphthalen- 2-yl)-1H-pyrazol-4(5H)-ylidene)hydrazinyl)phenyl) furan-2-carboxylic acid diethanolamine

CAS 1257792-42-9

1257792-41-8 (free acid) 1257792-41-8 (ethanolamine) 1257792-42-9 (olamine)

Jiangsu Hengrui Pharmaceutical, was approved in China in June 2021 for treatment of adult patients with chronic primary immune thrombocytopenia (ITP) and severe aplastic anemia who have not responded well to other treatments

Hetrombopag Olamine is the orally active ethanolamine salt of hetrombopag, a small-molecule, nonpeptide thrombopoietin receptor (TPO-R or CD110) agonist, with megakaryopoiesis-stimulating activity. Upon oral administration, hetrombopag targets, binds to and stimulates the transmembrane domain of the platelet TPO-R, a member of the hematopoietin receptor superfamily. Activation of TPO-R leads to the proliferation and differentiation of cells in the megakaryocytic lineage and an increase in platelet production. This may prevent or treat chemotherapy-induced thrombocytopenia.

  • OriginatorJiangsu Hengrui Medicine Co.
  • DeveloperAtridia; Jiangsu Hengrui Medicine Co.
  • ClassAntianaemics; Antihaemorrhagics; Aza compounds; Carboxylic acids; Furans; Pyrazolones; Small molecules; Tetrahydronaphthalenes
  • Mechanism of ActionThrombopoietin receptor agonists
  • Orphan Drug StatusYes – Thrombocytopenia
  • MarketedAplastic anaemia; Idiopathic thrombocytopenic purpura
  • Phase IIIThrombocytopenia
  • No development reportedUnspecified
  • 07 Dec 2024Efficacy and adverse events data from a phase-III trial in Aplastic anaemia presented at the 66th American Society of Hematology Annual Meeting and Exposition (ASH-Hem-2024)
  • 31 Jul 2024Phase-III clinical trials in Thrombocytopenia in China (PO) (NCT06507436)
  • 25 Jul 2024Jiangsu Hengrui Medicine plans a phase III trial in Thrombocytopenia (PO) in July 2024 (NCT06507436)

SYN

CN 113929668

https://patentscope.wipo.int/search/en/detail.jsf?docId=CN349207982&_cid=P21-MDCUSL-44897-1

Example 1. Synthesis of 5-(2-carbonyl-2,3-dihydrobenzoxazol-7-yl)furan-2-carboxylic acid
         
        Add purified water to the batching barrel, add 4.0kg of compound a under stirring, then add 10L of hydrochloric acid, stir, pump the material into a 50L reactor, add 10L of purified water to the batching barrel and pump it into the reactor. Turn on stirring, start cooling, the temperature drops to -5~2°C, start adding sodium nitrite aqueous solution (6.4L purified water, 1840g sodium nitrite), keep the temperature in the reactor no higher than 5°C during the process; after adding, continue stirring for 10~20min; add 800g of urea, continue stirring for 10~20min, the obtained diazonium salt solution is ready for use, and the temperature in the whole process is kept no higher than 5°C.
        44kg of acetone was pumped into a 200L reactor, and 15.0kg of compound b and 463.5g of copper chloride dihydrate were added in sequence under stirring. The temperature was raised to 30-35°C, and the obtained diazonium salt solution was added. The temperature was maintained at 30-40°C during the period. After the addition was completed, the temperature was maintained at 30-40°C and the reaction was continued with stirring for 1-1.5h. 120.0L of purified water was added, the temperature was raised to 40-45°C, and stirring was continued for a period of time. Filter, wash the filter cake with purified water until the filtrate is neutral, filter again, and collect the filter cake. 80L of purified water was added to the reactor, stirring was started, and the filter cake was added. Sodium hydroxide aqueous solution was added to the reactor to adjust the pH, the pH value was maintained at 8-10 for a period of time, and the filtrate was pumped into the reactor, and the filter was pressed into the material barrel through the filter press. Then 10L of purified water was pumped into the reactor and filtered into the material barrel. The material in the material barrel was pumped into the reactor, and then ethyl acetate was pumped in, stirred, and allowed to stand for 30-40 minutes. The aqueous phase was separated and collected, and the aqueous phase was pumped into the reactor, and the pH was adjusted to 3-4 with hydrochloric acid solution, and the filter cake was washed with purified water until the filtrate was neutral, and then the filter cake was collected. The filter cake was dried to obtain compound c. The yield of this step was 3.59 kg, and the yield was 55%.
        Example 2: Synthesis of 5-(3-amino-2-hydroxyphenyl)furan-2-carboxylic acid
         
        Purified water was pumped into the 50L reactor, stirring was started, 3.53kg of sodium hydroxide was added, and compound c obtained in the previous step was added. Under nitrogen protection, the reaction mixture was heated to reflux in the reactor for reaction. After the reaction, the reaction solution was cooled, the temperature was lowered to 0-10°C, and hydrochloric acid solution was added to adjust the pH value to 5-6. The filter cake was filtered, and the filtrate was washed with purified water until neutral, and then filtered again to collect the filter cake. The filter cake was dried to obtain compound d. The yield in this step was 2.78kg, with a yield of 90%.
        Example 3. Synthesis of (Z)-5-(2-hydroxy-(2-(3-methyl-5-oxo-1-(5,6,7,8-tetrahydronaphthalen-2-yl)-1H-pyrazol-4(5H)-ylidene)hydrazino)phenyl)furan-2-carboxylic acid
         
        Purified water was added to the batching barrel, and compound d was added in sequence under stirring, and then 6.3L hydrochloric acid was added, and the materials were pumped into a 200L reactor. Purified water was added to the batching barrel again, and then pumped into the reactor. Stirring was started, and the temperature was lowered to -5 to 2°C. Sodium nitrite aqueous solution (sodium nitrite to compound d molar ratio is 1:1) was added, and the internal temperature was kept at no more than 5°C during the process. After the addition was completed, stirring was continued; urea was added, and stirring was continued to obtain a diazonium salt solution for use, and the internal temperature was kept at no more than 5°C during the whole process.
        Add 36L purified water and 4000g sodium hydroxide to the batching barrel, stir to dissolve, and set aside. Take 26kg of the above sodium hydroxide aqueous solution, add compound e (the molar ratio of compound e to compound d is 0.9:1), stir, and add the resulting solution to the diazonium salt solution, keeping the temperature not exceeding 8°C. Add the above-prepared sodium hydroxide aqueous solution dropwise, adjust the pH to 8-10, and keep the temperature at 5-10°C for 3-4h. Add hydrochloric acid solution dropwise to adjust the pH to 2-3, keep the temperature not exceeding 25°C, filter, wash the filter cake with purified water until the filtrate is neutral, filter again, and collect the filter cake. Pump 48.0kg of tetrahydrofuran aqueous solution (22.5kg tetrahydrofuran, 25.5L purified water) into the reactor, add the above-obtained filter cake, beat, filter, wash the filter cake with tetrahydrofuran aqueous solution, wash the filter cake with purified water, filter again, and collect the filter cake. Dry the filter cake.
        Ethyl acetate was pumped into the reactor, and the above-obtained materials were added to the reactor for slurrying, and the filter cake was washed with ethyl acetate, and the filter cake was washed until no obvious droplets flowed out of the mirror, and the filter cake was collected and dried to obtain the compound of formula (I-2). The yield in this step was 5.34 kg, and the yield was 97.5%.
        Example 4. Synthesis of (Z)-5-(2-hydroxy-(2-(3-methyl-5-oxo-1-(5,6,7,8-tetrahydronaphthalen-2-yl)-1H-pyrazol-4(5H)-ylidene)hydrazino)phenyl)furan-2-carboxylic acid
        The compound of formula (I-2) was prepared by using a method substantially the same as in Example 3 (except that the equivalent of compound e was adjusted from 0.9 in Example 3 to the current 0.95, other conditions remained unchanged).
        Comparative Example 1: Synthesis of (Z)-5-(2-hydroxy-(2-(3-methyl-5-oxo-1-(5,6,7,8-tetrahydronaphthalen-2-yl)-1H-pyrazole-4(5H)-ylidene)hydrazino)phenyl)furan-2-carboxylic acid
         
        The compound of formula (I-2) was prepared by using a method substantially the same as in Example 3 (except that the step of adding urea was changed to starch potassium iodide test paper to indicate the reaction endpoint, and other conditions remained unchanged).
        Test Example 1: Effect of urea on the preparation process of the compound of formula (I-2)
        HPLC conditions:
        Chromatographic column: Welch Ultimate XB-C18 (4.6*150mm, 3μm), column temperature: 40℃,
        Flow rate: 1.0ml/min
        Injection volume: 10 μl
        Detector: UV detector
        Detection wavelength: 251nm
        Mobile phase: 0.1% trifluoroacetic acid aqueous solution was used as mobile phase A, acetonitrile was used as mobile phase B, and elution was performed at a ratio of 50%/50% of mobile phase A/mobile phase B.

PATENT

EP 2441457

PATENT

WO 2010142137

https://patentscope.wipo.int/search/en/detail.jsf?docId=WO2010142137&_cid=P21-MDCUXF-51461-1

PATENT

WO 2018133818

https://patentscope.wipo.int/search/en/detail.jsf?docId=WO2018133818&_cid=P21-MDCUYN-53075-1

Example 1. Preparation of 3-methyl-1-(5,6,7,8-tetrahydronaphthalen-2-yl)-1H-pyrazol-5-ol hydrochloride 

[0107]

[0108](5,6,7,8-tetrahydronaphthalene-2-yl)hydrazine hydrochloride (1.3 kg, prepared according to the method in patent application WO2009092276A1) and ethyl acetoacetate (1.17 L) were added to ethyl acetate (5.2 L). The mixture was heated under reflux for 2 hours. The reaction solution was cooled to room temperature, then cooled to 0-5°C, stirred for 1 hour, filtered, and the solid was washed with a small amount of ethyl acetate to obtain a white solid product (1.4 kg, yield 81%). 

[0109]

MS m/z(ESI):229.26[M-HCl+H]

[0110]Example 2. Preparation of (Z)-5-(2-hydroxy-3-(2-(3-methyl-5-oxo-1-(5,6,7,8-tetrahydronaphthalen-2-yl)-1,5-dihydro-4H-pyrazol-4-ylidene)hydrazino)phenyl)furan-2-carboxylic acid (V-1) 

[0111]

[0112]Step 1: Synthesis of intermediate (II-1) 

[0113]Purified water (14.80 kg), 7-aminobenzo[d]oxazol-2(3H)-one (2.00 kg, prepared according to the method in patent application WO2005016898A2), and hydrochloric acid (5.33 kg) were added to the reaction kettle, the temperature was raised to 40-45°C, stirred for 10 min, cooled to -3-5°C, and sodium nitrite aqueous solution (sodium nitrite 940 g, water 3.20 kg) was added dropwise, the internal temperature was kept at no more than 5°C, the end point was controlled by starch potassium iodide test paper, and stirring was continued for 15 min; 

[0114]Add acetone (28L) to the reactor, then add furoic acid (4.57kg) and cupric chloride dihydrate (232g), stir at 35-40℃ until dissolved, add diazonium salt solution dropwise, keep the internal temperature at 35-40℃, and continue stirring for 1.5h. Add purified water (60L), heat to 35-40℃ and stir for 30min. Filter, wash the filter cake with 45-50℃ purified water. Add the filter cake to purified water (40kg), adjust the pH to 8-9 with 15% sodium hydroxide aqueous solution, filter, adjust the pH of the filtrate to 3-4 with 6mol/L hydrochloric acid, filter, wash the filter cake with purified water, and dry to obtain a solid (1.63kg, yield 50%). 

[0115]Step 2: Synthesis of intermediate (III-1) 

[0116]The product from the previous step (1.4 kg) and 15% aqueous sodium hydroxide solution (9.7 kg) were heated to reflux under argon protection and reacted for 28 hours. The reaction solution was poured into ice water (5-6 kg), and hydrochloric acid (6N, 3 L) was slowly added to adjust the pH value to 5-6. The temperature was maintained below 20°C. During this period, ethyl acetate was added to eliminate bubbles. The mixture was filtered, washed with purified water, and dried to obtain a solid (1.18 kg, yield 94%). 

[0117]Step 3: Synthesis of intermediate (V-1) 

[0118]Add the product of the previous step (1.10kg), purified water (27.5kg), and hydrochloric acid (2.92kg) to the reactor in sequence, stir and dissolve, cool to -4 to -1°C, add sodium nitrite aqueous solution (346g sodium nitrite, 5.5kg water), and continue to react for 15min after the addition is completed. Cool to -8 to -5°C. Dissolve sodium hydroxide (1.48kg) in purified water (13.2kg) to obtain a 10% sodium hydroxide aqueous solution. Add 5-methyl-2-(5,6,7,8-tetrahydronaphthalen-2-yl)-2H-pyrazole-3-ol hydrochloride (1.26kg) to the above sodium hydroxide aqueous solution (10kg) to dissolve, and add the resulting solution to the diazonium salt solution at once, keeping the temperature not higher than 10°C. Add the remaining 10% sodium hydroxide aqueous solution, adjust the pH to 8 to 9, naturally heat to 8 to 12°C for reaction, and react for 4h. Add 6N hydrochloric acid, adjust pH=2-3, keep the temperature not more than 20°C, filter, and wash the filter cake with water until pH=6-7. Add the filter cake to 50% tetrahydrofuran aqueous solution (19kg), slurry at room temperature for 2h, filter, wash with 50% tetrahydrofuran aqueous solution, wash with water, and dry. Add ethyl acetate (20kg) to the solid, slurry at 40-45°C for 2h under argon protection, cool to room temperature, filter, wash with ethyl acetate, add the solid to ethyl acetate (20kg), slurry at 40-45°C for 2h under argon protection, cool to room temperature, filter, wash with ethyl acetate, and dry to obtain a solid (2.18kg, yield 95%, purity 99.5%). 

[0119]MS m/z(ESI):457.1[M-1] 

[0120]Example 3. Preparation of (Z)-5-(2-hydroxy-3-(2-(3-methyl-5-oxo-1-(5,6,7,8-tetrahydronaphthalen-2-yl)-1,5-dihydro-4H-pyrazol-4-ylidene)hydrazino)phenyl)furan-2-carboxylic acid ethanolamine salt (1:2) 

[0121]

[0122]Preparation of crude product 

[0123]The compound of formula (V-1) (1.8 kg) was suspended in a tetrahydrofuran/ethanol (14.5 kg, V/V = 2:1) mixed solvent at room temperature, stirred for 0.5 h, cooled to 10-15 ° C, and a tetrahydrofuran ethanol solution of ethanolamine (479.6 g) (tetrahydrofuran 91 g and ethanol 41 g) was added dropwise. The mixture was naturally heated to room temperature and reacted for 20 h. Filtered, washed with a tetrahydrofuran/ethanol (V/V = 2:1) mixed solvent, washed with ethyl acetate, filtered, and dried to obtain a dark red solid (1.73 kg, yield 76%, purity 99.7%). 

[0124]

1H-NMR(500MHz,D 2O+NaOH)δ7.725-7.741(d,1H),7.298-7.316(d,3H),7.183-7.198(d,1H),7.131-7.149(m,2H),6.612-6.643(t,1H),3.574-3.596(t,4H),2.759-2.778(br,4H),2.698-2.721(t,4H),2.428(s,3H),1.772(br,4H).

SYN
J.Med.Chem.2024,67,4376−4418

HetrombopagOlamine (Hengqu).

Hetrombopag olamine (6), an oral nonpeptide thrombopoietin receptor
(TpoR)agonistdevelopedby JiangsuHengruiPharmaceutical, was approved in China in June2021 for treatment of adult patients with chronic primary immune thrombocytopenia (ITP) and severe aplastic anemiawhohave not responded well to other treatments.46Hetrombopag, like other TpoR agonists, increases platelet production by binding to the transmembranedomainofTpoRinprogenitorcells, inducing
megakaryocytes.Theeffectisadditivewiththeactionofnative thrombopoietin, whichbinds to the extracellular domainof TpoR.Hetrombopag is structurallyrelatedtoeltrombopag, a previously approvedTpoR, withmodifications to enhance potencyandminimizetoxicity.46−48InaPhaseIIIclinicaltrial, ITPpatients demonstratedadurableplatelet response, with reducedbleedingriskanduseof rescuetherapycomparedto
placebo.49 Akilo-scale, chromatography-freesynthesisofhetrombopag has been reported by researchers at Jiangsu Hengrui Pharmaceutical in the Chinese-language patent literature (Scheme 12).50,51 Commercially available aniline 6.1 was coupledwith furoic acid (6.2) using aMeerwein arylation reaction togive intermediate6.3.This process first involves diazotizationof the anilineusing sodiumnitrite andhydrochloricacid.Ureawasusedtoquenchtheresidualnitrousacid, animprovement thatultimatelygavetheproductwithhigher purity and lower levels of specific impurities; the crude
diazoniumsalt solutionwas carried forwarddirectlywithout furthermanipulation.Furoicacid(6.2)inacetonewastreated withcopper(II)chloridedihydratefollowedbyadditionofthe
diazonium salt solution to affect the arylation. The crude productwaspurifiedbyacid−baseextractionandisolatedby filtrationtoprovide6.3 in55%yield.Basichydrolysisof the
cycliccarbamateunveiledthefreeanilineandphenolmoieties in arene 6.4. Nucleophilic attack of the enolate anion of pyrazolone 6.5 (see Scheme 13) on the diazoniumsalt of aniline6.4 formed the central hydrazonemoiety ina JappKlingemann-like reaction. The crude product was triturated withethylacetatetorapidlyprovidehetrombopagfreebasein
97.5%yield.TreatmentwithethanolamineinTHFandEtOH thengeneratedhetrombopagolamine (6) in76%yieldand 99.7%purity.51 Pyrazolone intermediate6.5was synthesized in two steps
(Scheme 13).52,53 5,6,7,8-Tetrahydronaphthalen-2-yl amine (6.6)was converted to the diazoniumion and reduced in situ to the corresponding hydrazine 6.7 using stannous chloridedihydrate.Condensationof thehydrazinewithethyl acetoacetate in ethyl acetate and in situ cyclization gave pyrazolone6.5.While the synthesis fromaniline6.1 to the activepharmaceutical ingredient(API)6wasreportedonthe
kilo-scale, thesynthesisofpyrazolone6.5wasreportedonlyon gram-scale

(46) Syed, Y. Y. Hetrombopag: First approval. Drugs 2021, 81, 1581−1585.
(47) Xie, C.; Zhao, H.; Bao, X.; Fu, H.; Lou, L. Pharmacological characterization of hetrombopag, a novel orally active human thrombopoietin receptor agonist. J. Cell. Mol. Med. 2018, 22, 5367−5377.
(48) Zheng, L.; Liang, M.-z.; Zeng, X.-l.; Li, C.-z.; Zhang, Y.-f.; Chen, X.-y.; Zhu, X.; Xiang, A.-b. Safety, pharmacokinetics and pharmacodynamics of hetrombopag olamine, a novel TPO-R agonist, in healthy individuals. Basic Clin. Pharmacol. Toxicol. 2017, 121, 414−422.
(49) Mei, H.; Liu, X.; Li, Y.; Zhou, H.; Feng, Y.; Gao, G.; Cheng, P.; Huang, R.; Yang, L.; Hu, J.; Hou, M.; Yao, Y.; Liu, L.; Wang, Y.; Wu, D.; Zhang, L.; Zheng, C.; Shen, X.; Hu, Q.; Liu, J.; Jin, J.; Luo, J.; Zeng, Y.; Gao, S.; Zhang, X.; Zhou, X.; Shi, Q.; Xia, R.; Xie, X.; Jiang, Z.; Gao, L.; Bai, Y.; Li, Y.; Xiong, J.; Li, R.; Zou, J.; Niu, T.; Yang, R.;
Hu, Y. A multicenter, randomized phase III trial of hetrombopag: a novel thrombopoietin receptor agonist for the treatment of immune thrombocytopenia. J. Hematol. Oncol. 2021, 14, 37.
(50) Shi, A.; Diao, A.; Du, Y. Preparation of bicyclic substituted pyrazolone azo derivatives. China Patent CN 113929668, 2022.
(51) Diao, A.; Gao, X.; Bian, L. Method for preparing bicyclo substituted pyrazolone azo derivatives and intermediates. WO 2018133818, 2018.
(52) Tang, P. C.; Lue, H.; Fei, H.; Chen, Y. Preparation of pyrazole derivatives as thrombopoietin receptor agonists. WO 2010142137, 2010.
(53) Tang, P. C.; Lue, H.; Fei, H.; Chen, Y. Salts of bicyclo substituted pyrazolon azo derivatives, preparation method and use
thereof. European Patent EP 2441457, 2014.

.

str1

AS ON JUNE2025 4.45 LAKHS VIEWS ON BLOG WORLDREACH AVAILABLEFOR YOUR ADVERTISEMENT

wdt-16

join me on Linkedin

Anthony Melvin Crasto Ph.D – India | LinkedIn

join me on Researchgate

RESEARCHGATE

This image has an empty alt attribute; its file name is research.jpg

join me on Facebook

Anthony Melvin Crasto Dr. | Facebook

join me on twitter

Anthony Melvin Crasto Dr. | twitter

+919321316780 call whatsaapp

EMAIL. amcrasto@gmail.com

……

//////////Hetrombopag Olamine, CHINA 2021, APPROVALS 2021, Hetrombopag diolamine, SHR 8735 olamine, Hetrombopag ethanolamine, SHR-8735 olamine, V45T2I862X, RAFUTROMBOPAG OLAMINE

AZVUDINE


AZVUDINE

CAS


1011529-10-4

WeightAverage: 286.223
Monoisotopic: 286.082581021

Chemical FormulaC9H11FN6O4

  • FNC
  • HY-19314
  • RO 0622
  • RO-0622
  • SB17040

  • IJ2XP0ID0K
  • DTXSID901027757

4-amino-1-[(2R,3S,4R,5R)-5-azido-3-fluoro-4-hydroxy-5-(hydroxymethyl)oxolan-2-yl]-1,2-dihydropyrimidin-2-one

Azvudine is an antiviral drug which acts as a reverse transcriptase inhibitor.[3] It was discovered for the treatment of hepatitis C[4] and has since been investigated for use against other viral diseases such as AIDS and COVID-19,[2][5] for which it was granted conditional approval in China.[6][7]

Azvudine was first discovered in 2007.[8] It costs 350 Chinese yuan per 7 days for COVID, as of November 2022.[9]

Azvudine is under investigation in clinical trial NCT04668235 (Study on Safety and Clinical Efficacy of AZVUDINE in COVID-19 Patients (Sars-cov-2 Infected)).

Azvudine (RO-0622) is a potent nucleoside reverse transcriptase inhibitor (NRTI), with antiviral activity on HIVHBV and HCV. Azvudine exerts highly potent inhibition on HIV-1 (EC50s ranging from 0.03 to 6.92 nM) and HIV-2 (EC50s ranging from 0.018 to 0.025 nM). Azvudine inhibits NRTI-resistant viral strains. Azvudine is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. It can also undergo strain-promoted alkyne-azide cycloaddition (SPAAC) reactions with molecules containing DBCO or BCN groups.

SYN

https://patents.google.com/patent/CN111892636A/en

According to the inventor’s research and understanding, at present, the synthesis of azvudine mainly includes the following methods according to different raw materials:

1. It is prepared by using a ribonucleotide as a raw material. The method requires a total of 15 steps of reaction to obtain the target product. The inventor’s research found that DAST is used as a fluorination reagent in the fluorination process of this method, which has large steric hindrance and is difficult to fluoride, and the route process is complicated and the route is long. Low cost, high cost, not suitable for industrial production.

2. It is prepared by using 1,3,5-O-tribenzoyl-2-deoxy-2-fluoro-D-arabinofuranoside as raw material. The inventors have found that the preparation raw materials are not easy to obtain, and the route involves uridine to In the conversion reaction of cytidine, the reaction route is further extended, thus limiting the further application of this method.

3. Using ribonucleotides as raw materials to synthesize, the inventors found that this method requires 12 steps to synthesize the target product, and DAST is also used as a fluorination reagent in the fluorination process, which has large steric hindrance and low fluorination efficiency.

4. It is prepared by using uracil nucleotide as raw material. The inventors have found that the raw material cost of this method is relatively high, it involves the conversion process of uridine to cytidine, and the reaction yield is not high.

To sum up, the inventors have found that the currently known processes for preparing azvudine have the following disadvantages: synthesizing uracil nucleotides with ribonucleotides as raw materials, and then converting uracil nucleotides into target products, synthesizing uracil nucleotides. The process routes all exceed 12 steps, and the fluorination reaction uses DAST (diethylaminosulfur trifluoride) reagent, which increases the difficulty of the reaction due to steric hindrance, reduces the yield, and brings difficulties to industrial production.

Example 1

Figure BDA0002623551980000063
Figure BDA0002623551980000063

Accurately weigh 4.86 g of cytidine (compound 1), dissolve it in 20 mL of ethanol, then add 4.52 g of benzoic anhydride, raise the temperature to 60° C., and stir overnight. After the reaction was completed, the solvent was removed under reduced pressure, and 100 mL of deionized water was added to wash and filter to obtain compound 2 (96.5% yield). The structural characterization is shown in Figure 1 .

Example 2

Figure BDA0002623551980000071
Figure BDA0002623551980000071

Weigh 3.5 g of compound 2, dissolve in 25 mL of pyridine, ice-water bath at 0°C, add 3.0 mL of TIPDS under nitrogen protection, react for 1 h, decompose the reaction mixture with water, remove pyridine under reduced pressure, extract with chloroform, and wash with saturated aqueous sodium bicarbonate solution , and dried over anhydrous sodium sulfate to obtain compound 3 (83.6% yield). The structural characterization is shown in Figure 2.

Example 3

Figure BDA0002623551980000072
Figure BDA0002623551980000072

Weigh 5.9 g of compound 3, dissolve it in 100 mL of tetrahydrofuran, add 2.82 g of trifluoromethanesulfonic anhydride (Tf 2 O), and react at room temperature for 2 h under nitrogen protection. Then, the reaction temperature was lowered to -20°C, 2.46 g of tetrabutylammonium fluoride (Bu 4 NF) was added, and the reaction was continued for 10 h. After the reaction was completed, tetrahydrofuran was removed under reduced pressure, extracted with chloroform, washed with saturated aqueous sodium bicarbonate solution, and dried over anhydrous sodium sulfate to obtain compound 4 (86.8% yield). The structural characterization is shown in Figure 3.

Example 4

Figure BDA0002623551980000073
Figure BDA0002623551980000073

5.9 g of compound 3 was weighed, dissolved in 100 mL of dichloromethane and 10 mL of anhydrous pyridine, cooled to -50°C under nitrogen protection, added with 1.61 g of DAST, and reacted for 12 h. After the reaction was completed, the solvent was removed under reduced pressure, extracted with chloroform, washed with saturated aqueous sodium bicarbonate solution, and dried over anhydrous sodium sulfate to obtain compound 4 (76.0% yield).

Example 5

Figure BDA0002623551980000074
Figure BDA0002623551980000074

Weigh 3.5g of compound 4, add 100mL of tetrahydrofuran, add 0.5g of imidazole, 0.5g of triphenylphosphine, slowly add 3.75g of tetrahydrofuran solution containing 10wt% iodine, stir at room temperature for 5h, the reaction is complete, remove the solvent under reduced pressure, Compound 5 was prepared (84% yield) and the structural characterization is shown in Figure 4 .

Example 6

Figure BDA0002623551980000081
Figure BDA0002623551980000081

Weigh 4.59g of compound 5, dissolve it in 100mL of methanol, add 0.5g of DBU, control the temperature to 60°C, react for 12h, cool to room temperature, add saturated aqueous sodium chloride solution, adjust the acidic pH=3 with 1M hydrochloric acid, extract with ethyl acetate, It was dried over anhydrous sodium sulfate and concentrated under reduced pressure to obtain compound 6 (77.4% yield). The structural characterization is shown in Figure 5 .

Example 7

Figure BDA0002623551980000082
Figure BDA0002623551980000082

Weigh 3.3 g of compound 6, add 50 mL of DMF solution dissolved with 0.6 g of sodium azide, add 50 mL of DMF solution dissolved with 0.6 g of ICl, control the temperature to 0 ° C, and react for 12 h. After the reaction is completed, add sodium bisulfite until The color of iodine disappears completely. The solvent was removed under reduced pressure to obtain compound 7 (77% yield). The structural characterization is shown in FIG. 6 .

Example 8

Figure BDA0002623551980000083
Figure BDA0002623551980000083

Weigh 2.5 g of compound 7, dissolve it in 50 mL of DMF, add 0.65 g of benzoic acid, add 0.5 g of silver acetate, and stir at room temperature for 12 h. After the reaction was completed, the mixture was filtered, and the solvent was removed under reduced pressure to obtain compound 8 (71.2% yield). The structural characterization is shown in FIG. 7 .

Example 9

Figure BDA0002623551980000084
Figure BDA0002623551980000084

Weigh 4.82 g of compound 8, add 100 mL of methanol, 10 mL of deionized water, 3 mL of triethylamine, stir at room temperature for 5 h, and remove the solvent under reduced pressure to obtain compound 9 (88.7% yield). The structural characterization is shown in Figure 8.

SYN

https://pubs.acs.org/doi/10.1021/acs.oprd.4c00166

Azvudine was approved for the treatment of adult HIV-1 infection in China in 2021, and it was approved for conditional marketing for the treatment of SARS-CoV-2 in China in 2022. In this work, we describe a fully continuous flow synthesis of 2′-deoxy-2′-fluoroarabinoside, a key intermediate for azvudine. The process was accomplished via six chemical transformations, including chlorination, hydrolysis, fluorination, bromination, condensation, and deprotection in six sequential continuous flow devices. Under the optimized process conditions, the total yield was 32.3% with a total residence time of 156 min. Compared with batch conditions, the total yield was doubled, the total reaction time was shortened 16 times, and the E factor was reduced 1.63 times.

1,3,5-Tri-O-benzoyl-D-ribofuranose (FR-1)
To a stirred solution of O-acetyl-2,3,5-tri-O-benzoyl-β-D-ribofuranose (FR-0,
1.008 g, 2.0 mmol) in anhydrous dichloromethane (DCM, 10 mL) was added
dropwise thionyl chloride (0.713 g,6 mmol) at 0 oC, and the resulting mixture
allowed to stir at room temperature for 14 h. The solution was evaporated,
dissolved with toluene (5 mL× 3), and then evaporated. To the residue was
added DCM (10 mL) and water (5 mL), and and continued stirring at room
temperature for 2 h. The solution was then washed with saturated aqueous
NaHCO3 (15 mL) and dried over Na2SO4, filtered and evaporated. DCM (2 mL)
and n-Hexane (20 mL) was added to the residue and the mixture was stirred at
room. A white solid was collected by filtration to give FR-1 (yield: 47.8%).
2-Deoxy-2-fluoro-1,3,5-tri-O-benzoyl-D-ribofuranose (FR-F)
To a stirred solution of FR-1 (0.924 g, 2.0 mmol) in anhydrous DCM (10 mL) was
added dropwise DAST (0.976 g, 6.0 mmol) for 30 min, and the resulting mixture
allowed to stir at 40 °C (16 h). The reaction was cooled and quenched with
saturated aqueous NaHCO3 (15 mL). The solution was extracted with DCM and
water, and then washed with saturated aqueous NaHCO3 (20 mL). This was then
dried over Na2SO4, filtered and evaporated. The crude product was purified by
silica gel column chromatography (ethyl acetate: petroleum ether =1:10) to
obtain a white solid (yield: 41.2%).
α-D-Arabinofuranosyl bromide, 2-deoxy-2-fluoro-, 3,5-dibenzoate (FR-Br)
To a stirred solution of FR-F (0.928 g, 2.0 mmol) in anhydrous DCM (10 mL) was
added dropwise 33.3% HBr-HOAc (1.47 g, 6.0 mmol) at 0 oC, and the resulting
mixture were allowed to stir at room temperature for 7 h. The reaction was
quenched with saturated aqueous NaHCO3 (10 mL), dried over Na2SO4, filtered
and evaporated to yield the product (FR-Br) as a brown oil (yield: 99.8%).

1-(2-deoxy-2-fluoro-3,5-di-O-benzoyl-β-D-arabino-furanosyl)uracil (FAU-Bz)
A mixture of uracil (0.336 g, 3 mmol) and (NH4)2SO4 (10 mg, 0.075 mmol) in
hexamethyldisilazane (HMDS) (6 mL) was refluxed under nitrogen for 5 h. To
the silylated uracil solution was added a solution of FR-Br in dry acetonitrile (10
mL) and the mixture was refluxed under nitrogen for 5 h. The solution was
evaporated, extracted with DCM (20 mL) and washed with saturated aqueous
NaHCO3 (15 mL). This was then dried over Na2SO4, filtered and evaporated.
Ethyl acetate (10 mL) and petroleum ether (50 mL) was added to the residue
and the mixture was stirred at room temperature. A light yellow solid was
collected by filtration to give FAU-Bz (yield: 83.2%).
2′-deoxy-2′-fluoro- arabinoside (FAU)
To a solution of FUA-Bz (0.908 g, 2.0 mmol) in anhydrous methanol (MeOH, 10
mL) was added NH3-MeOH (5 mL), stirred at room temperature for 15 h and
evaporated to dryness under reduced pressure. White solid

SYN

: J. Med. Chem. 2024, 67, 4376−4418

Azvudine (1). Azvudine (1) is an antiviral manufactured by China-based Genuine Biotech. It was
approved in China in 2021 as a first-in-class treatment for human immunodeficiency virus (HIV). It has a dual function, acting as a reverse transcriptase inhibitor and targeting the viral infectivity factor/apolipoprotein B mRNA-editing enzyme, catalytic subunit 3G (Vif/A3G) protein−protein interaction.6 Azvudine has activity against both wild-type and drug-resistant strains of HIV due to the presence of a 3′-hydroxy group and substitution in the 4′-position of the ribose core.7 Due to its known antiviral activity, azvudine was repurposed as a treatment for COVID-19 and approved for this indication inChina in 2022. It acts as an RNA-dependent RNA polymerase (RdRp) inhibitor, the same mechanism as the previously approved molnupiravir and remdesivir. In addition to its antiviral activity, concentration of the drug in the thymus has suggested immune-targeting activity; this dual function is unique among RdRp inhibitors.8 Several syntheses of azvudine have been reported in the scientific and patent literature. Scheme 1 highlights a 100 g scale synthesis from a patent filed by Shandong University.9 Other syntheses are similar, containing the furanose functional group manipulations in 1.5−1.8, though these routes differ in choice of nucleobase and protecting group strategy, and were reported on a smaller scale.10−12 The synthesis began from benzoyl-protected fluoro-furanose 1.1. Bromination with HBr in acetic acid followed by displacement of the bromide 1.2 with protected cytosine 1.3 yielded intermediate 1.4. Deprotection of the benzoyl groups with ammonia in MeOH formed diol 1.5, and a Mitsunobu reaction converted the
primary alcohol to alkyl iodide 1.6. Elimination of the iodide with sodium methoxide followed by addition of sodium azide and iodine monochloride across the resulting alkene produced substitution in the 4′-position of the ribose core.7 Due to its known antiviral activity, azvudine was repurposed as a treatment for COVID-19 and approved for this indication in China in 2022. It acts as an RNA-dependent RNA polymerase (RdRp) inhibitor, the same mechanism as the previously approved molnupiravir and remdesivir. In addition to its antiviral activity, concentration of the drug in the thymus has suggested immune-targeting activity; this dual function is unique among RdRp inhibitors.8 Several syntheses of azvudine have been reported in the scientific and patent literature. Scheme 1 highlights a 100 g scale synthesis from a patent filed by Shandong University.9 Other syntheses are similar, containing the furanose functional group manipulations in 1.5−1.8, though these routes differ in choice of nucleobase and protecting group strategy, and were reported on a smaller scale.10−12 The synthesis began from
benzoyl-protected fluoro-furanose 1.1. Bromination with HBr in acetic acid followed by displacement of the bromide 1.2 with protected cytosine 1.3 yielded intermediate 1.4. Deprotection of the benzoyl groups with ammonia in MeOH formed diol 1.5, and a Mitsunobu reaction converted the primary alcohol to alkyl iodide 1.6. Elimination of the iodide with sodium methoxide followed by addition of sodium azide
and iodine monochloride across the resulting alkene producedazide 1.7. Both the alcohol and amine were reprotected with benzoyl chloride, and the iodide was displaced with metachlorobenzoic acid in an oxidative nucleophilic substitution reaction to yield penultimate intermediate 1.9. All protecting
groups were then removed with ammonia in MeOH to yield
azvudine (1).

(6) Sun, L.; Peng, Y.; Yu, W.; Zhang, Y.; Liang, L.; Song, C.; Hou, J.;
Qiao, Y.; Wang, Q.; Chen, J.; et al. Mechanistic insight into
antiretroviral potency of 2’-deoxy-2’-beta-fluoro-4’-azidocytidine
(FNC) with a long-lasting effect on HIV-1 prevention. J. Med.
Chem. 2020, 63, 8554−8566.
(7) Chang, J. 4’-Modified nucleosides for antiviral drug discovery:
achievements and perspectives. Acc. Chem. Res. 2022, 55, 565−578.
(8) Zhang, J.-L.; Li, Y.-H.; Wang, L.-L.; Liu, H.-Q.; Lu, S.-Y.; Liu, Y.;
Li, K.; Liu, B.; Li, S.-Y.; Shao, F.-M.; Wang, K.; Sheng, N.; Li, R.; Cui,
J.-J.; Sun, P.-C.; Ma, C.-X.; Zhu, B.; Wang, Z.; Wan, Y.-H.; Yu, S.-S.;
Che, Y.; Wang, C.-Y.; Wang, C.; Zhang, Q.; Zhao, L.-M.; Peng, X.-Z.;
Cheng, Z.; Chang, J.-B.; Jiang, J.-D. Azvudine is a thymus-homing
anti-SARS-CoV-2 drug effective in treating COVID-19 patients. Signal
Transduct. Target Ther. 2021, 6, 414.
(9) Chen, X.; Wang, Z.; Yu, H.; Liu, X. Preparation method of
azvudine and its intermediates. China Patent CN 115960147, 2023.
(10) Smith, D. B.; Kalayanov, G.; Sund, C.; Winqvist, A.; Maltseva,
T.; Leveque, V. J.-P.; Rajyaguru, S.; Pogam, S. L.; Najera, I.;
Benkestock, K.; Zhou, X.-X.; Kaiser, A. C.; Maag, H.; Cammack, N.;
Martin, J. A.; Swallow, S.; Johansson, N. G.; Klumpp, K.; Smith, M.
The design, synthesis, and antiviral activity of monofluoro and
difluoro analogues of 4’-azidocytidine against hepatitis C virus
replication: The discovery of 4’-azido-2’-deoxy-2’-fluorocytidine and4’-azido-2’-dideoxy-2’,2’-difluorocytidine. J. Med. Chem. 2009, 52,
2971−2978.
(11) Wang, Q.; Hu, W.; Wang, S.; Pan, Z.; Tao, L.; Guo, X.; Qian,
K.; Chen, C. H.; Lee, K. H.; Chang, J. Synthesis of new 2’-deoxy-2’-
fluoro-4’-azido nucleoside analogues as potent anti-HIV agents. Eur. J.
Med. Chem. 2011, 46, 4178−83.
(12) Deng, W.; Jiang, S.; Yu, T.; Zhai, D. Synthesis method of
azvudine. China Patent CN 111892636, 2020.

Medical uses

In July 2021, azvudine became conditionally approved in China for the following indication: “to treat high-viral-load cases of HIV-1, in combination with a nucleoside reverse-transcriptase inhibitor and a non-nucleoside reverse-transcriptase inhibitor”. The approval text describes it as a dual reverse transcriptase and Vif inhibitor.[10]

In July 2022, azvudine received emergency conditional approval for COVID-19 in adults.[11] It is believed to work by inhibiting the RNA-dependent RNA polymerase (RdRp) enzyme in the SARS-CoV-2 virus.[12][13]

Adverse effects

According to the manufacturer, phase II trials of azvudine in combination with doravirine and tenofovir disoproxil fumarate in HIV patients found an adverse effect profile similar to, but milder, than lamivudine combined with the two drugs. Very common (> 10%) side effects include dizziness, elevated liver enzymes, vomiting, and elevated alkaline phosphatase. Common (> 1%) side effects include nausea, elevated blood lipids, fever, insomnia, tiredness, and diarrhea. Detailed numbers are provided by Genuine in the slides and the medication package insert.[14][15] A boxed warning is present at the beginning of the Chinese package insert, describing a risk of “decrease in absolute neutrophil count, increase in total bilirubin, increase in glutathione aminotransferase, and increase in blood glucose”.[15]

The small (n=10) open-label pilot study for azvudine used alone in COVID reported no adverse events.[16]

Non-human models

Azvudine is found to be mutagenic in in vitro in the Ames test, CHL test, and in vitro in the mice micronucleus test.[17]

Azvudine is toxic to the reproductive system of rats and rabbit. The minimum reproductive NOAEL found for males is 5.0 mg/kg/d and for females 0.5 mg/kg/d. It is excreted in rat breast milk; the NOAEL for rat pups is 1.5 mg/kg/d.[17]

Azvudine is mainly toxic to the immune system, bone marrow, and digestive system of model animals. The chronic NOAELs are 0.5 mg/kg/d (rat, 3 months), 0.3 mg/kg/d (rat, 26 weeks), and 0.1 mg/kg/d (beagle dog, 1 month and 39 weeks).[17] For comparison, the chronic human dose for HIV treatment is 0.05 mg/kg/d, using the reference 3 mg dose and an average Chinese body mass of 59.5 kg (2014).

History

Azvudine was first found in literature in a patent filed by Chang Jun-biao of Zhengzhou University.[8] It received its current name in 2009, when researchers at Roche independently discovered it as a Hep C RNA polymerase inhibitor in vitro.[4] In the following years, Chinese scientists tested it in vitro for a number of targets, most importantly HBV (human and duck) and HTLV-1, two viruses with a reverse transcriptase.[18][19][20]

It was first proposed as an HIV treatment in 2011, when in vitro tests by the Chang group provided positive results.[21] In 2014, its oral pharmokinetics in rats was elucidated.[1] A phase II study (NCT04109183) was finished in March 2019 by Genuine Biotech. In August 2020, the Chang group found that the substance inhibits vif in vitro.[22] In the same month, China’s drug regulator (NMPA) decided to fast-track the approval process, labelling it a first-in-class medication.[14] In July 2021, NMPA granted conditional approval for HIV-1.[7] It was included in the 2021 HIV treatment recommendnation by the Chinese Medical Association and Chinese CDC, published October that year.[14] Curiously, no full results of the trial have been made available for this study in any journal detailing the experiment design as of December 2022.[23] Parts of the results are shown on the drug monograph as well as a 2022 slides deck produced by Genuine for the NHSA available on the latter’s website.[14]

Azvudine was found to inhibit some coronaviruses in vitro around 2020, leading to an interest in its use in COVID. An open-label pilot study on mild and moderate cases was performed in 2020, with mildly positive results.[16] A phase III trial was performed in 2022 in China. In July 2022, China’s drug regulator granted conditional approval for it to be used to treat COVID-19, following a local phase III trial.[6] Initially, no detailed description of the said trial was published in any journals, but state media quoted some numbers from the developer: “40% clinical improvement in 7 days by FNC group, compared to 11% in control”.[7] It is unclear how such “improvement” is defined.

Four phase III clinical trials investigated azvudine’s efficacy and safety in adults with mild-to-moderate COVID-19. The findings indicate that azvudine may reduce the time to eliminate detectable levels of virus (viral load) and improve symptoms faster than standard treatment. In trials, it was reported to be safe with few side effects. However, some studies produced inconsistent results in terms of symptom improvement and severe illness prevention. Additionally, the studies tended to use a smaller number of participants than other major COVID-19 drug trials.[12][13]

Society and culture

Genuine owns two different tradenames for this medication: 双新艾克 (literally “dual new AIDS inhibitor”) for HIV use[14] and 捷倍安 (literally “fast extra safe”) for COVID use.[7] No generics are available.

Geniune holds one patent related to the drug: the original 2007 patent on the entire class of 2′-fluorine-4′-substituted nucleotides, purchased from Zhengzhou University.[8] Two other Chinese patents on synthesizing the drug are found on Google Patents, but the owners do not appear to be connected to Geniune.[24] Roche held one 2002 patent, CNA028118480A (CN1516590A), over the broader class of 4′-substituted nucleotides. The patent was voided in 2019 after Riboscience, its new holder, stopped paying fees.[25]

References

  1.  Peng Y, Cheng T, Dong L, Zhang Y, Chen X, Jiang J, et al. (September 2014). “Quantification of 2′-deoxy-2′-β-fluoro-4′-azidocytidine in rat and dog plasma using liquid chromatography-quadrupole time-of-flight and liquid chromatography-triple quadrupole mass spectrometry: Application to bioavailability and pharmacokinetic studies”. Journal of Pharmaceutical and Biomedical Analysis98: 379–386. doi:10.1016/j.jpba.2014.06.019PMID 24999865.
  2.  Liu Y, Liu B, Zhang Y, Peng Y, Huang C, Wang N, et al. (July 2017). “Intestinal absorption mechanisms of 2′-deoxy-2′-β-fluoro-4′-azidocytidine, a cytidine analog for AIDS treatment, and its interaction with P-glycoprotein, multidrug resistance-associated protein 2 and breast cancer resistance protein”. European Journal of Pharmaceutical Sciences105: 150–158. doi:10.1016/j.ejps.2017.05.009PMID 28487144S2CID 4252337.
  3.  Wang RR, Yang QH, Luo RH, Peng YM, Dai SX, Zhang XJ, et al. (2014). “Azvudine, a novel nucleoside reverse transcriptase inhibitor showed good drug combination features and better inhibition on drug-resistant strains than lamivudine in vitro”PLOS ONE9 (8): e105617. Bibcode:2014PLoSO…9j5617Wdoi:10.1371/journal.pone.0105617PMC 4140803PMID 25144636.
  4.  Smith DB, Kalayanov G, Sund C, Winqvist A, Maltseva T, Leveque VJ, et al. (May 2009). “The design, synthesis, and antiviral activity of monofluoro and difluoro analogues of 4′-azidocytidine against hepatitis C virus replication: the discovery of 4′-azido-2′-deoxy-2′-fluorocytidine and 4′-azido-2′-dideoxy-2′,2′-difluorocytidine”. Journal of Medicinal Chemistry52 (9): 2971–2978. doi:10.1021/jm801595cPMID 19341305.
  5.  Harrison C (April 2020). “Coronavirus puts drug repurposing on the fast track”Nature Biotechnology38 (4): 379–381. doi:10.1038/d41587-020-00003-1PMID 32205870.
  6.  Ye Y (July 2022). “China approves first homegrown COVID antiviral”. Naturedoi:10.1038/d41586-022-02050-xPMID 35883009S2CID 251104078.
  7.  “首个国产抗新冠口服药附条件获批上市” [First domestic oral anti-Covid drug conditionally approved]. 新华网. 证券日报. 2022-07-26. Archived from the original on 2022-08-09. Retrieved 2022-07-26.
  8.  Chang J, Bao X, Wang Q, Guo X, Wang W, Qi X. Preparation of 2′-fluoro-4′-substituted nucleoside analogs as antiviral agents. 20070807. Chinese Patent Application No: CN 2007-10137548. Chinese Patent No: CN 101177442A, 20080514.
  9.  “新冠口服药阿兹夫定片线上开售, 每瓶售价350元” [Oral COVID drug Azvudine tablet available online at 350 yuan/bottle]. Xinmin Evening News. 19 November 2022. Retrieved 28 December 2022 – via Beijing Daily (repost).
  10.  “国家药监局附条件批准阿兹夫定片上市” [NMPA conditionally approvals azvudine tablets]. http://www.nmpa.gov.cn (in Chinese). 2021-07-21.
  11.  “国家药监局应急附条件批准河南真实生物科技有限公司阿兹夫定片增加新冠肺炎治疗适应症注册申请” [NMPA grants emergency conditional approval for additional indication registration of azvudine tablets (Hebei Genuine Biotech Co., Ltd.)]. http://www.nmpa.gov.cn. 2022-07-25.
  12.  Zhu KW (2023). “Efficacy and safety evaluation of Azvudine in the prospective treatment of COVID-19 based on four phase III clinical trials”Frontiers in Pharmacology14: 1228548. doi:10.3389/fphar.2023.1228548PMC 10484631PMID 37693894.
  13.  Wang Y, Xie H, Wang L, Fan J, Zhang Y, Pan S, Zhou W, Chen Q, Liu X, Wu A, Zhang H, Wang J, Tian X (February 2024). “Effectiveness of azvudine in reducing mortality of COVID-19 patients: a systematic review and meta-analysis”Virology Journal21 (1): 46. doi:10.1186/s12985-024-02316-yPMC 10893615PMID 38395970.
  14.  Genuine Biotech (July 11, 2022). “阿兹夫定片(双新艾克)” [Azvudine Tablets (Shuāngxīnàikè)]. NHSA.gov.cn. Archived from the original on 2022-09-06.
  15.  “阿兹夫定片说明书” [Azvudine Tablets, Monograph] (PDF). WUXU DATA. Retrieved 2023-01-03.
  16.  Ren Z, Luo H, Yu Z, Song J, Liang L, Wang L, et al. (October 2020). “A Randomized, Open-Label, Controlled Clinical Trial of Azvudine Tablets in the Treatment of Mild and Common COVID-19, a Pilot Study”Advanced Science7 (19): e2001435. doi:10.1002/advs.202001435PMC 7404576PMID 35403380.
  17.  Drug Review Center (China) (June 30, 2022). “阿兹夫定片 (CXHS2000016-17) 申请上市技术审评报告” [Azvudine tabs (CHXS2000016-17) request for marketing technical review report] (PDF). WUXU DATA. Retrieved 2023-01-03.
  18.  Wang Q, Liu X, Wang Q, Zhang Y, Jiang J, Guo X, et al. (April 2011). “FNC, a novel nucleoside analogue inhibits cell proliferation and tumor growth in a variety of human cancer cells”. Biochemical Pharmacology81 (7): 848–855. doi:10.1016/j.bcp.2011.01.001PMID 21219886.
  19.  Zheng L, Wang Q, Yang X, Guo X, Chen L, Tao L, et al. (2012). “Antiviral activity of FNC, 2′-deoxy-2′-β-fluoro-4′-azidocytidine, against human and duck HBV replication”. Antiviral Therapy17 (4): 679–687. doi:10.3851/IMP2094PMID 22452880S2CID 25576607.
  20.  Zhou Y, Zhang Y, Yang X, Zhao J, Zheng L, Sun C, et al. (2012). “Novel nucleoside analogue FNC is effective against both wild-type and lamivudine-resistant HBV clinical isolates”Antiviral Therapy17 (8): 1593–1599. doi:10.3851/IMP2292PMID 22910281S2CID 29382902.
  21.  Wang Q, Hu W, Wang S, Pan Z, Tao L, Guo X, et al. (September 2011). “Synthesis of new 2′-deoxy-2′-fluoro-4′-azido nucleoside analogues as potent anti-HIV agents”European Journal of Medicinal Chemistry46 (9): 4178–4183. doi:10.1016/j.ejmech.2011.06.020PMC 3164908PMID 21745701.
  22.  Sun L, Peng Y, Yu W, Zhang Y, Liang L, Song C, et al. (August 2020). “Mechanistic Insight into Antiretroviral Potency of 2′-Deoxy-2′-β-fluoro-4′-azidocytidine (FNC) with a Long-Lasting Effect on HIV-1 Prevention”. Journal of Medicinal Chemistry63 (15): 8554–8566. doi:10.1021/acs.jmedchem.0c00940PMID 32678592S2CID 220631451.
  23.  Li G, Wang Y, De Clercq E (April 2022). “Approved HIV reverse transcriptase inhibitors in the past decade”Acta Pharmaceutica Sinica. B12 (4): 1567–1590. doi:10.1016/j.apsb.2021.11.009PMC 9279714PMID 35847492.
  24.  Google Patents Search, “阿兹夫定” (with quotes), CN114149475A, CN111892636A.
  25.  Guokr.com (10 August 2022). “真实生物的真实面目”Huxiu.com. Retrieved 30 December 2022.

Further reading

Clinical data
Trade names捷倍安, 双新艾克
Other names2′-Deoxy-2′-β-fluoro-4′-azidocytidine (FNC), RO-0622
Legal status
Legal statusUS: Investigational drugCN: Conditional use Rx
Pharmacokinetic data
Bioavailability83% (rat, dog)[1]
Metabolismliver (CYP3A)[2]
Elimination half-life4 hours (dog)[1]
Identifiers
IUPAC name
CAS Number1011529-10-4 
PubChem CID24769759
DrugBankDB16407
ChemSpider24717759
UNIIIJ2XP0ID0K
ChEMBLChEMBL519846
Chemical and physical data
FormulaC9H11FN6O4
Molar mass286.223 g·mol−1
3D model (JSmol)Interactive image
SMILES
InChI

///////AZVUDINE, Genuine Biotech, APPROVALS 2022, CHINA 2022, FNC, HY 19314, RO 0622, RO-0622, SB17040, IJ2XP0ID0K, DTXSID901027757

str1

AS ON JUNE2025 4.45 LAKHS VIEWS ON BLOG WORLDREACH AVAILABLEFOR YOUR ADVERTISEMENT

wdt-16

join me on Linkedin

Anthony Melvin Crasto Ph.D – India | LinkedIn

join me on Researchgate

RESEARCHGATE

This image has an empty alt attribute; its file name is research.jpg

join me on Facebook

Anthony Melvin Crasto Dr. | Facebook

join me on twitter

Anthony Melvin Crasto Dr. | twitter

+919321316780 call whatsaapp

EMAIL. amcrasto@gmail.com

……

Adagrasib


Adagrasib.svg

Adagrasib

FormulaC32H35ClFN7O2
cas 2326521-71-3
Mol weight604.1174
Antineoplastic
  DiseaseNon-small cell lung cancer
2022/12/12

FDA APPROVED, KRAZATI (Mirati Therapeutics)

  • MRTX-849
  • MRTX849
  • KRAS G12C inhibitor MRTX849

Adagrasib, sold under the brand name Krazati, is an anticancer medication used to treat non-small cell lung cancer.[1][2] Adagrasib is an inhibitor of the RAS GTPase family.[1] It is taken by mouth.[1] It is being developed by Mirati Therapeutics.[1][3]

The most common adverse reactions include diarrhea, nausea, fatigue, vomiting, musculoskeletal pain, hepatotoxicity, renal impairment, dyspnea, edema, decreased appetite, cough, pneumonia, dizziness, constipation, abdominal pain, and QTc interval prolongation.[2] The most common laboratory abnormalities include decreased lymphocytes, increased aspartate aminotransferase, decreased sodium, decreased hemoglobin, increased creatinine, decreased albumin, increased alanine aminotransferase, increased lipase, decreased platelets, decreased magnesium, and decreased potassium.[2]

It was approved for medical use in the United States in December 2022.[1][3]

Synthesis Reference

Fell, Jay B et al. “Identification of the Clinical Development Candidate MRTX849, a Covalent KRASG12C Inhibitor for the Treatment of Cancer.” Journal of medicinal chemistry vol. 63,13 (2020): 6679-6693. doi:10.1021/acs.jmedchem.9b02052

Journal of Medicinal Chemistry (2020), 63(13), 6679-6693

PATENT

WO2020101736 https://patents.google.com/patent/WO2020101736A1/en

EXAMPLE 7

Figure imgf000140_0001

2-[(2S)-4-[7-(8-chloro-1-naphthyl)-2-[[(2S)-1-methylpyrrolidin-2-yl]methoxy]-6,8-dihydro-5H- pyrido[3,4-d]pyrimidin-4-yl]-1-(2-fluoroprop-2-enoyl)piperazin-2-yl]acetonitrile

Figure imgf000140_0002

[0432] 2-fluoroprop-2-enoyl chloride. To a solution of 2-fluoroprop-2-enoic acid (400 mg, 4.44 mmol, 1 eq) in DCM (4 mL) was added (COCl)2 (846 mg, 6.66 mmol, 583 µL, 1.5 eq) and DMF (32.5 mg, 444 umol, 34.2 µL, 0.1 eq). The mixture was stirred at 25 °C for 2 hrs. The reaction mixture was concentrated under reduced pressure to remove a part of solvent and give a residue in DCM. Compound 2-fluoroprop-2-enoyl chloride (400 mg, crude) was obtained as a yellow liquid and used into the next step without further purification. [0433] Step A: 2-[(2S)-4-[7-(8-chloro-1-naphthyl)-2-[[(2S)-1- methylpyrrolidin-2-yl]methoxy]- 6,8-dihydro-5H-pyrido[3,4-d]pyrimidin-4-yl]-1-(2-fluoroprop-2-enoyl)piperazin-2- yl]acetonitrile. To a solution of 2-[(2S)-4-[7-(8-chloro-1-naphthyl)-2-[[(2S)- 1-methylpyrrolidin- 2-yl]methoxy]-6,8-dihydro-5H-pyrido[3,4-d]pyrimidin-4-yl]piperazin-2-yl]acetonitrile (300 mg, 528 umol, 1 eq, HCl) in DCM (5 mL) was added DIEA (1.73 g, 13.4 mmol, 2.33 mL, 25.4 eq) and 2-fluoroprop-2-enoyl chloride (286 mg, 2.64 mmol, 5 eq) in DCM (5 mL). The mixture was stirred at 0 °C for 1 hour. The reaction mixture was concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (Al2O3, Dichloromethane/Methanol = 10/1 to 10/1). The residue was purified by prep-HPLC (column: Gemini 150 * 25 5u; mobile phase: [water (0.05% ammonia hydroxide v / v) – ACN]; B%: 55% – 85%, 12min). The residue was purified by prep-HPLC (column: Phenomenex Synergi C18 150 * 30mm * 4um; mobile phase: [water (0.225% FA) – ACN]; B%: 20% – 50%, 10.5min). The residue was concentrated under reduced pressure to remove ACN, and then lyophlization. Title compound 2-[(2S)-4-[7-(8-chloro- 1-naphthyl)-2-[[(2S)-1- methylpyrrolidin-2-yl]methoxy]-6,8-dihydro-5H-pyrido[3,4-d]pyrimidin- 4-yl]-1-(2-fluoroprop-2-enoyl)piperazin-2-yl]acetonitrile (EXAMPLE 7, 24.1 mg, 36.7 umol, 7% yield, 99.1% purity, FA) was obtained as a brown solid. [0434] SFC condition: “AD – 3S_3_5_40_3ML Column: Chiralpak AD – 3 100 × 4.6mm I.D., 3um Mobile phase: methanol (0.05% DEA) in CO2 from 5% to 40% Flow rate: 3mL/min Wavelength: 220nm”. [0435] 1H NMR (400 MHz, Acetic) d = 7.82 (d, J = 8.0 Hz, 1H), 7.69 (d, J = 8.0 Hz, 1H), 7.56 (d, J = 7.6 Hz, 1H), 7.49 (t, J = 7.6 Hz, 1H), 7.41 – 7.30 (m, 2H), 5.58 – 5.25 (m, 2H), 5.17 – 4.59 (m, 4H), 4.57 – 4.28 (m, 3H), 4.24 – 3.78 (m, 4H), 3.67 – 3.13 (m, 7H), 3.08 (br d, J = 2.4 Hz, 3H), 2.98 (br d, J = 6.4 Hz, 1H), 2.83 – 2.61 (m, 1H), 2.45 – 2.29 (m, 1H), 2.24 – 2.08 (m, 3H). 

PATENT

US20190144444 https://patents.google.com/patent/US20190144444A1/en

////////

str1
Flag Counter

AS ON DEC2021 3,491,869 VIEWS ON BLOG WORLDREACH AVAILABLEFOR YOUR ADVERTISEMENT

wdt-16

join me on Linkedin

Anthony Melvin Crasto Ph.D – India | LinkedIn

join me on Researchgate

RESEARCHGATE

This image has an empty alt attribute; its file name is research.jpg

join me on Facebook

Anthony Melvin Crasto Dr. | Facebook

join me on twitter

Anthony Melvin Crasto Dr. | twitter

+919321316780 call whatsaapp

EMAIL. amcrasto@amcrasto

/////////////////////////////////////////////////////////////////////////////

Adagrasib (MRTX849) is an oral, small-molecule KRAS inhibitor developed by Mirati Therapeutics. KRAS mutations are highly common in cancer and account for approximately 85% of all RAS family mutations.5 However, the development of KRAS inhibitors has been challenging due to their high affinity for guanosine triphosphate (GTP) and guanosine diphosphate (GDP), as well as the lack of a clear binding pocket.1 Adagrasib targets KRASG12C, one of the most common KRAS mutations, at the cysteine 12 residue and inhibits KRAS-dependent signalling.2 In a phase I/IB clinical study that included patients with KRASG12C-mutated advanced solid tumors (NCT03785249), adagrasib exhibited anti-tumor activity. The phase II of the same study showed that in patients with KRASG12C-mutated non-small-cell lung cancer (NSCLC), adagrasib was efficient without new safety signals.2,3,6

In February 2022, the FDA accepted a new drug application (NDA) for adagrasib for the treatment of patients with previously treated KRASG12C–positive NSCLC.7 In December 2022, the FDA granted accelerated approval to adagrasib for the treatment of KRASG12C-mutated locally advanced or metastatic NSCLC who have received at least one prior systemic therapy.8,9 Adagrasib joins sotorasib as another KRASG12C inhibitor approved by the FDA.4

Medical uses

Adagrasib is indicated for the treatment of adults with KRAS G12C-mutated locally advanced or metastatic non-small cell lung cancer (NSCLC), as determined by an FDA approved test, who have received at least one prior systemic therapy.[1][2][4]

History

Approval by the US Food and Drug Administration (FDA) was based on KRYSTAL-1, a multicenter, single-arm, open-label clinical trial (NCT03785249) which included participants with locally advanced or metastatic non-small cell lung cancer with KRAS G12C mutations.[2] Efficacy was evaluated in 112 participants whose disease has progressed on or after platinum-based chemotherapy and an immune checkpoint inhibitor, given either concurrently or sequentially.[2]

The FDA granted the application for adagrasib fast-trackbreakthrough therapy, and orphan drug designations.[2]

Research

It is undergoing clinical trials.[5][6][7][8][9][10]

References

  1. Jump up to:a b c d e f g https://www.accessdata.fda.gov/drugsatfda_docs/label/2022/216340s000lbl.pdf
  2. Jump up to:a b c d e f g h “FDA grants accelerated approval to adagrasib for KRAS G12C-mutated NSC”U.S. Food and Drug Administration (FDA). 12 December 2022. Retrieved 14 December 2022. Public Domain This article incorporates text from this source, which is in the public domain.
  3. Jump up to:a b “Mirati Therapeutics Announces U.S. FDA Accelerated Approval of Krazati (adagrasib) as a Targeted Treatment Option for Patients with Locally Advanced or Metastatic Non-Small Cell Lung Cancer (NSCLC) with a KRASG12C Mutation” (Press release). Mirati Therapeutics Inc. 12 December 2022. Retrieved 13 December 2022 – via MultiVu.
  4. ^ https://www.accessdata.fda.gov/drugsatfda_docs/appletter/2022/216340Orig1s000ltr.pdf Public Domain This article incorporates text from this source, which is in the public domain.
  5. ^ Hallin J, Engstrom LD, Hargis L, Calinisan A, Aranda R, Briere DM, et al. (January 2020). “The KRASG12C Inhibitor MRTX849 Provides Insight toward Therapeutic Susceptibility of KRAS-Mutant Cancers in Mouse Models and Patients”Cancer Discovery10 (1): 54–71. doi:10.1158/2159-8290.CD-19-1167PMC 6954325PMID 31658955.
  6. ^ Fell JB, Fischer JP, Baer BR, Blake JF, Bouhana K, Briere DM, et al. (July 2020). “Identification of the Clinical Development Candidate MRTX849, a Covalent KRASG12C Inhibitor for the Treatment of Cancer”Journal of Medicinal Chemistry63 (13): 6679–6693. doi:10.1021/acs.jmedchem.9b02052PMID 32250617.
  7. ^ Thein KZ, Biter AB, Hong DS (January 2021). “Therapeutics Targeting Mutant KRAS”. Annual Review of Medicine72: 349–364. doi:10.1146/annurev-med-080819-033145PMID 33138715S2CID 226242453.
  8. ^ Christensen JG, Olson P, Briere T, Wiel C, Bergo MO (August 2020). “Targeting Krasg12c -mutant cancer with a mutation-specific inhibitor”Journal of Internal Medicine288 (2): 183–191. doi:10.1111/joim.13057PMID 32176377.
  9. ^ Dunnett-Kane V, Nicola P, Blackhall F, Lindsay C (January 2021). “Mechanisms of Resistance to KRASG12C Inhibitors”Cancers13 (1): 151. doi:10.3390/cancers13010151PMC 7795113PMID 33466360.
  10. ^ Jänne PA, Riely GJ, Gadgeel SM, Heist RS, Ou SI, Pacheco JM, et al. (July 2022). “Adagrasib in Non–Small-Cell Lung Cancer Harboring a KRASG12C Mutation”New England Journal of Medicine387 (2): 120–131. doi:10.1056/NEJMoa2204619PMID 35658005S2CID 249352736.

External links

  • “Adagrasib”Drug Information Portal. U.S. National Library of Medicine.
  • Clinical trial number NCT03785249 for “Phase 1/2 Study of MRTX849 in Patients With Cancer Having a KRAS G12C Mutation KRYSTAL-1” at ClinicalTrials.gov

///////Adagrasib, KRAZATI, FDA 2022, APPROVALS 2022, MRTX-849, MRTX849,  Mirati Therapeutics

[H][C@@]1(COC2=NC3=C(CCN(C3)C3=CC=CC4=C3C(Cl)=CC=C4)C(=N2)N2CCN(C(=O)C(F)=C)[C@@]([H])(CC#N)C2)CCCN1C

wdt

NEW DRUG APPROVALS

ONE TIME

$10.00

Nirsevimab


(Heavy chain)
QVQLVQSGAE VKKPGSSVMV SCQASGGLLE DYIINWVRQA PGQGPEWMGG IIPVLGTVHY
GPKFQGRVTI TADESTDTAY MELSSLRSED TAMYYCATET ALVVSETYLP HYFDNWGQGT
LVTVSSASTK GPSVFPLAPS SKSTSGGTAA LGCLVKDYFP EPVTVSWNSG ALTSGVHTFP
AVLQSSGLYS LSSVVTVPSS SLGTQTYICN VNHKPSNTKV DKRVEPKSCD KTHTCPPCPA
PELLGGPSVF LFPPKPKDTL YITREPEVTC VVVDVSHEDP EVKFNWYVDG VEVHNAKTKP
REEQYNSTYR VVSVLTVLHQ DWLNGKEYKC KVSNKALPAP IEKTISKAKG QPREPQVYTL
PPSREEMTKN QVSLTCLVKG FYPSDIAVEW ESNGQPENNY KTTPPVLDSD GSFFLYSKLT
VDKSRWQQGN VFSCSVMHEA LHNHYTQKSL SLSPGK
(Light chain)
DIQMTQSPSS LSAAVGDRVT ITCQASQDIV NYLNWYQQKP GKAPKLLIYV ASNLETGVPS
RFSGSGSGTD FSLTISSLQP EDVATYYCQQ YDNLPLTFGG GTKVEIKRTV AAPSVFIFPP
SDEQLKSGTA SVVCLLNNFY PREAKVQWKV DNALQSGNSQ ESVTEQDSKD STYSLSSTLT
LSKADYEKHK VYACEVTHQG LSSPVTKSFN RGEC
(Disulfide bridge: H22-H96, H153-H209, H229-L214, H235-H’235, H238-H’238, H270-H330, H376-H434, H’22-H’96, H’153-H’209, H’229-L’214, H’270-H’330, H’376-H’434, L23-L88, L’23-L’88, L134-L194, L’134-L’194)

>Heavy_chain
QVQLVQSGAEVKKPGSSVMVSCQASGGLLEDYIINWVRQAPGQGPEWMGGIIPVLGTVHY
GPKFQGRVTITADESTDTAYMELSSLRSEDTAMYYCATETALVVSETYLPHYFDNWGQGT
LVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP
AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPA
PELLGGPSVFLFPPKPKDTLYITREPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP
REEQYNSTYRVVSVLTVLHQDWLEGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL
PPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT
VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>Light_chain
DIQMTQSPSSLSAAVGDRVTITCQASQDIVNYLNWYQQKPGKAPKLLIYVASNLETGVPS
RFSGSGSGTDFSLTISSLQPEDVATYYCQQYDNLPLTFGGGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Nirsevimab

EMS APPROVED 2022/10/31, Beyfortus, AstraZeneca AB

FormulaC6494H10060N1708O2050S46
CAS1989556-22-0
Mol weight146334.5658

Monoclonal antibody
Prevention of respiratory syncytial virus infection

  • Immunoglobulin g1-kappa, anti-(human respiratory syncytial virus fusion glycoprotein f0 (protein f))human monoclonal antibody.gamma.1 heavy chain (1-456) (human vh (homo sapiens ighv1-69*01(ighd)-ighj4*01 (90.1%)) (8.8.19) (1-126) -homo sapiens ighg1*03
  • Immunoglobulin g1, anti-(human respiratory syncytial virus fusion protein)(human monoclonal med18897 .gamma.1-chain), disulfide with monoclonal med18897 .kappa.-chain, dimer

Synthesis Reference

Khan, AA et al. (2020) Dosage regimens for and compositions including anti-rsv antibodies. (U.S. Patent No. 2020/0347120 A1). U.S. Patent and Trademark Office. https://patentimages.storage.googleapis.com/6b/d2/10/a841b66e0c90cf/US20200347120A1.pdf

Nirsevimab, sold under the brand name Beyfortus, is a human recombinant monoclonal antibody with activity against respiratory syncytial virus, or RSV for infants.[2][3] It is under development by AstraZeneca and Sanofi.[2][3] Nirsevimab is designed to bind to the fusion protein on the surface of the RSV virus.[4][5]

The most common side effects reported for nirsevimab are rash, pyrexia (fever) and injection site reactions (such as redness, swelling and pain where the injection is given).[6]

Nirsevimab was approved for medical use in the European Union in November 2022.[1][7]

Nirsevimab (MEDI8897) is a recombinant human immunoglobulin G1 kappa (IgG1ĸ) monoclonal antibody used to prevent respiratory syncytial virus (RSV) lower respiratory tract disease in neonates and infants.6 It binds to the prefusion conformation of the RSV F protein, a glycoprotein involved in the membrane fusion step of the viral entry process, and neutralizes several RSV A and B strains.6,1 Compared to palivizumab, another anti-RSV antibody, nirsevimab shows greater potency at reducing pulmonary viral loads in animal models. In addition, nirsevimab was developed as a single-dose treatment for all infants experiencing their first RSV season, whereas palivizumab requires five monthly doses to cover an RSV season.5 This is due to a modification in the Fc region of nirsevimab that grants it a longer half-time compared to typical monoclonal antibodies.1,6

On November 2022, nirsevimab was approved by the EMA for the prevention of RSV lower respiratory tract disease in newborns and infants during their first RSV season.6

////////

str1
Flag Counter

AS ON DEC2021 3,491,869 VIEWS ON BLOG WORLDREACH AVAILABLEFOR YOUR ADVERTISEMENT

wdt-16

join me on Linkedin

Anthony Melvin Crasto Ph.D – India | LinkedIn

join me on Researchgate

RESEARCHGATE

This image has an empty alt attribute; its file name is research.jpg

join me on Facebook

Anthony Melvin Crasto Dr. | Facebook

join me on twitter

Anthony Melvin Crasto Dr. | twitter

+919321316780 call whatsaapp

EMAIL. amcrasto@amcrasto

/////////////////////////////////////////////////////////////////////////////

Monoclonal antibody
TypeWhole antibody
SourceHuman
TargetF protein of RSV
Clinical data
Trade namesBeyfortus
Other namesMED-18897, MEDI8897
Routes of
administration
Intramuscular
ATC codeNone
Legal status
Legal statusEU: Rx-only [1]
Identifiers
CAS Number1989556-22-0
PubChem SID384585358
DrugBankDB16258
UNIIVRN8S9CW5V
KEGGD11380
ChEMBLChEMBL4297575
Chemical and physical data
FormulaC6494H10060N1708O2050S46
Molar mass146336.58 g·mol−1

Adverse effects

No major hypersensitivity reactions have been reported, and adverse events of grade 3 or higher were only reported in 8% (77 of 968) of participants in clinical trial NCT02878330.[8][4]

Pharmacology

Mechanism of action

Nirsevimab binds to the prefusion conformation of the RSV fusion protein, i.e. it binds to the site at which the virus would attach to a cell; effectively rendering it useless. It has a modified Fc region, extending the half-life of the drug in order for it to last the whole RSV season.[4]

History

The opinion by the Committee for Medicinal Products for Human Use (CHMP) of the European Medicines Agency (EMA) is based on data from two randomized, double-blind, placebo-controlled multicenter clinical trials that investigated the efficacy and safety of nirsevimab in healthy preterm (premature) and full-term infants entering their first respiratory syncytial virus (RSV) season.[6] These studies demonstrated that nirsevimab prevents lower respiratory tract infection caused by RSV requiring medical attention (such as bronchiolitis and pneumonia) in term and preterm infants during their first RSV season.[6]

The safety of nirsevimab was also evaluated in a phase II/III, randomized, double‑blind, multicenter trial in infants who were born five or more weeks prematurely (less than 35 weeks gestation) at higher risk for severe RSV disease and infants with chronic lung disease of prematurity (i.e. long-term respiratory problems faced by babies born prematurely) or congenital heart disease.[6] The results of this study showed that nirsevimab had a similar safety profile compared to palivizumab (Synagis).[6]

Society and culture

Legal status

On 15 September 2022, the Committee for Medicinal Products for Human Use (CHMP) of the European Medicines Agency (EMA) adopted a positive opinion, recommending the granting of a marketing authorization for the medicinal product Beyfortus, intended for the prevention of respiratory syncytial virus (RSV) lower respiratory tract disease in newborns and infants.[9][6] Beyfortus was reviewed under EMA’s accelerated assessment program.[9] The applicant for this medicinal product is AstraZeneca AB.[9] Nirsevimab was approved for medical use in the European Union in November 2022.[1][7]

Research

Nirsevimab is being investigated as an experimental vaccine against respiratory syncytial virus, RSV, in the general infant population.[2][3] The MELODY study is an ongoing, randomized, double-blind, placebo-controlled to evaluate the safety and efficacy of nirsevimab in late preterm and term infants. Initial results have been promising, with nirsevimab reducing LRTI (lower respiratory tract infections) by 74.5% compared to placebo in infants born at term or late preterm.[5][10][11]

Ongoing trials for nirsevimab are:

References

  1. Jump up to:a b c “Beyfortus”Union Register of medicinal products. 3 November 2022. Retrieved 6 November 2022.
  2. Jump up to:a b c “Nirsevimab demonstrated protection against respiratory syncytial virus disease in healthy infants in Phase 3 trial” (Press release). Sanofi. 26 April 2021. Archived from the original on 27 December 2021. Retrieved 27 December 2021.
  3. Jump up to:a b c “Nirsevimab MELODY Phase III trial met primary endpoint of reducing RSV lower respiratory tract infections in healthy infants” (Press release). AstraZeneca. 26 April 2021. Archived from the original on 26 December 2021. Retrieved 27 December 2021.
  4. Jump up to:a b c Griffin MP, Yuan Y, Takas T, Domachowske JB, Madhi SA, Manzoni P, et al. (Nirsevimab Study Group) (July 2020). “Single-Dose Nirsevimab for Prevention of RSV in Preterm Infants”The New England Journal of Medicine383 (5): 415–425. doi:10.1056/NEJMoa1913556PMID 32726528S2CID 220876651.
  5. Jump up to:a b Hammitt LL, Dagan R, Yuan Y, Baca Cots M, Bosheva M, Madhi SA, et al. (March 2022). “Nirsevimab for Prevention of RSV in Healthy Late-Preterm and Term Infants”The New England Journal of Medicine386 (9): 837–846. doi:10.1056/NEJMoa2110275PMID 35235726S2CID 247220023.
  6. Jump up to:a b c d e f “New medicine to protect babies and infants from respiratory syncytial virus (RSV) infection”European Medicines Agency (EMA) (Press release). 16 September 2022. Archived from the original on 19 September 2022. Retrieved 18 September 2022. Text was copied from this source which is copyright European Medicines Agency. Reproduction is authorized provided the source is acknowledged.
  7. Jump up to:a b “Beyfortus approved in the EU for the prevention of RSV lower respiratory tract disease in infants”AstraZeneca (Press release). 4 November 2022. Retrieved 6 November 2022.
  8. ^ Clinical trial number NCT02878330 at ClinicalTrials.gov
  9. Jump up to:a b c “Beyfortus: Pending EC decision”European Medicines Agency (EMA). 15 September 2022. Archived from the original on 19 September 2022. Retrieved 18 September 2022. Text was copied from this source which is copyright European Medicines Agency. Reproduction is authorized provided the source is acknowledged.
  10. ^ Zacks Equity Research (25 March 2022). “Pfizer’s (PFE) RSV Jab Gets Another Breakthrough Therapy Tag”NasdaqArchived from the original on 8 April 2022. Retrieved 8 April 2022.
  11. ^ “Nirsevimab significantly protected infants against RSV disease in Phase III MELODY trial”AstraZeneca (Press release). 3 March 2022. Retrieved 6 November 2022.

////////////Nirsevimab, EU 2022, APPROVALS 2022, PEPTIDE, Monoclonal antibody, respiratory syncytial virus infection, ANTIVIRAL, 1989556-22-0, MED-18897, MEDI8897, AstraZeneca AB

wdt-2

NEW DRUG APPROVALS

ONE TIME

$10.00

Olutasidenib


Olutasidenib.svg

Olutasidenib

  • FT-2102
  • FT2102

C18H15ClN4O2

354.79

CAS1887014-12-1

Rezlidhia (Forma Therapeutics)

SYN Caravella JA, et al. Structure-Based Design and Identification of FT-2102 (Olutasidenib), a Potent Mutant-Selective IDH1 Inhibitor. J Med Chem. 2020 Feb 27;63(4):1612-1623. doi: 10.1021/acs.jmedchem.9b01423. Epub 2020 Feb 12.

FDA 12/1/2022, To treat adults with relapsed or refractory acute myeloid leukemia with a susceptible isocitrate dehydrogenase-1 (IDH1) mutation, Rezlidhia

Olutasidenib, sold under the brand name Rezlidhia, is an anticancer medication used to treat relapsed or refractory acute myeloid leukemia.[1][2] Olutasidenib is an isocitrate dehydrogenase-1 (IDH1) inhibitor.[1] It is taken by mouth.[1]

Olutasidenib was approved for medical use in the United States in December 2022.[1][2][3][4]

Medical uses

Olutasidenib is indicated for the treatment of adults with relapsed or refractory acute myeloid leukemia with a susceptible isocitrate dehydrogenase-1 (IDH1) mutation as detected by an FDA-approved test.[1][2]

Society and culture

Names

Olutasidenib is the international nonproprietary name.[5]

Olutasidenib is an isocitrate dehydrogenase-1 (IDH1) inhibitor indicated for the treatment of patients with relapsed or refractory acute myeloid leukemia with a susceptible IDH1 mutation as detected by an FDA-approved test.

Olutasidenib (FT-2102) is a selective and potent isocitrate dehydrogenase-1 (IDH1) inhibitor approved by the FDA in December 2022.5,6 It is indicated for the treatment of relapsed or refractory acute myeloid leukemia (AML) in patients with a susceptible IDH1 mutation as determined by an FDA-approved test.5 IDH1 mutations are common in different types of cancer, such as gliomas, AML, intrahepatic cholangiocarcinoma, chondrosarcoma, and myelodysplastic syndromes (MDS), and they lead to an increase in 2-hydroxyglutarate (2-HG), a metabolite that participates in tumerogenesis.1,2 Olutasidenib inhibits the mutated IDH1 specifically, and provides a therapeutic benefit in IDH1-mutated cancers.1,5

Other IDH1 inhibitors, such as ivosidenib, have also been approved for the treatment of relapsed or refractory AML.3,4 Olutasidenib is orally bioavailable and capable of penetrating the blood-brain barrier, and is also being evaluated for the treatment of myelodysplastic syndrome (MDS), as well as solid tumors and gliomas (NCT03684811).4

SYN

https://pubs.acs.org/doi/10.1021/acs.jmedchem.9b01423

a Reagents and conditions: (a) DIEA, DMSO, 80−110 °C, 16 h, 67%; (b) (R)-2-methylpropane-2-sulfinamide, CuSO4, 55 °C, DCE, 16 h, 81%; (c) MeMgBr, DCM, −50 to −60 °C, 3 h, 63%; (d) 1 N HCl, dioxane, reflux, 16 h, >98%, 98.4% ee; (e) m-CPBA, CHCl3, reflux, 4 days, 52%; (f) Ac2O, reflux, 3 days, 60%; (g) K2CO3, MeOH, 4 h, 92%; (h) MeI, K2CO3, DMF, 45 min, 67%.


1H NMR (300 MHz,
DMSO-d6) δ 12.07 (s, 1 H), 7.71−7.76 (m, 2 H), 7.51 (dd, J = 8.79,
2.35 Hz, 1 H), 7.31 (d, J = 8.79 Hz, 1 H), 6.97 (d, J = 7.92 Hz, 1 H),
6.93 (d, J = 7.92 Hz, 1 H), 5.95 (d, J = 7.92 Hz, 1 H), 4.62−4.75 (m,
1 H), 3.58 (s, 3 H), 1.50 (d, J = 6.74 Hz, 3 H); 13C NMR (75 MHz,
DMSO-d6) δ 161.0, 155.9, 141.4, 136.6, 135.0, 133.4, 129.8, 126.7,
125.8, 120.1, 119.4, 116.7, 115.1, 104.5, 103.7, 47.4, 34.0, 20.3; LCMS
(method 2) >95% purity; tR 10.18 min; m/z 355, 357 [M + H]+
;
HRMS (ESI) calcd for C18H16ClN4O2 [M + H]+ 355.0962 found
356.0956.

////////

str1
Flag Counter

AS ON DEC2021 3,491,869 VIEWS ON BLOG WORLDREACH AVAILABLEFOR YOUR ADVERTISEMENT

wdt-16

join me on Linkedin

Anthony Melvin Crasto Ph.D – India | LinkedIn

join me on Researchgate

RESEARCHGATE

This image has an empty alt attribute; its file name is research.jpg

join me on Facebook

Anthony Melvin Crasto Dr. | Facebook

join me on twitter

Anthony Melvin Crasto Dr. | twitter

+919321316780 call whatsaapp

EMAIL. amcrasto@amcrasto

/////////////////////////////////////////////////////////////////////////////

Clinical data
Trade namesRezlidhia
Other namesFT-2102
License dataUS DailyMedOlutasidenib
Routes of
administration
By mouth
ATC codeNone
Legal status
Legal statusUS: ℞-only [1][2]
Identifiers
CAS Number1887014-12-1
PubChem CID118955396
IUPHAR/BPS10319
DrugBankDB16267
ChemSpider72380144
UNII0T4IMT8S5Z
KEGGD12483
ChEMBLChEMBL4297610
PDB ligandPWV (PDBeRCSB PDB)
Chemical and physical data
FormulaC18H15ClN4O2
Molar mass354.79 g·mol−1
3D model (JSmol)Interactive image
showSMILES

References

  1. Jump up to:a b c d e f https://www.accessdata.fda.gov/drugsatfda_docs/label/2022/215814s000lbl.pdf
  2. Jump up to:a b c d https://www.accessdata.fda.gov/drugsatfda_docs/appletter/2022/215814Orig1s000ltr.pdf Public Domain This article incorporates text from this source, which is in the public domain.
  3. ^ “Rigel Announces U.S. FDA Approval of Rezlidhia (olutasidenib) for the Treatment of Adult Patients with Relapsed or Refractory Acute Myeloid Leukemia with a Susceptible IDH1 Mutation”Rigel Pharmaceuticals, Inc. (Press release). 1 December 2022. Retrieved 2 December 2022.
  4. ^ “Rigel Announces U.S. FDA Approval of Rezlidhia (olutasidenib) for the Treatment of Adult Patients with Relapsed or Refractory Acute Myeloid Leukemia with a Susceptible IDH1 Mutation” (Press release). Rigel Pharmaceuticals. 1 December 2022. Retrieved 2 December 2022 – via PR Newswire.
  5. ^ World Health Organization (2019). “International nonproprietary names for pharmaceutical substances (INN): recommended INN: list 82”. WHO Drug Information33 (3). hdl:10665/330879.

Further reading

External links

  • “Olutasidenib”Drug Information Portal. U.S. National Library of Medicine.
  • Clinical trial number NCT02719574 for “Open-label Study of FT-2102 With or Without Azacitidine or Cytarabine in Patients With AML or MDS With an IDH1 Mutation” at ClinicalTrials.gov

/////////////Olutasidenib, FDA 2022, APPROVALS 2022, Rezlidhia, FT-2102, FT 2102

wdt-1

NEW DRUG APPROVALS

ONE TIME

$10.00

Mirvetuximab soravtansine-gynx


STR1

Mirvetuximab soravtansine-gynx

FDA 11/14/2022,To treat patients with recurrent ovarian cancer that is resistant to platinum therapy

Elahere

FDA Approves Mirvetuximab Soravtansine-gynx for FRα+ Platinum-resistant Ovarian Cancer

https://www.biochempeg.com/article/315.html

4846-85a8-48171ab38275

FDA Approves Mirvetuximab Soravtansine-gynx for FRα+ Platinum-resistant Ovarian Cancer

November 15, 2022

Kristi Rosa

The FDA has granted accelerated approval to mirvetuximab soravtansine-gynx (Elahere) for the treatment of select patients with folate receptor α–positive, platinum-resistant epithelial ovarian, fallopian tube, or primary peritoneal cancer.

The FDA has granted accelerated approval to mirvetuximab soravtansine-gynx (Elahere) for the treatment of adult patients with folate receptor α (Frα)–positive, platinum-resistant epithelial ovarian, fallopian tube, or primary peritoneal cancer, who have received 1 to 3 prior systemic treatment regimens.1-3

The regulatory agency also gave the green light to the VENTANA FOLR1 (FOLR-2.1) RxDx Assay for use as a companion diagnostic device to identify patients who are eligible to receive the agent. Testing can be done on fresh or archived tissue. Newly diagnosed patients can be tested at diagnosis to determine whether this agent will be an option for them at the time of progression to platinum resistance.

The decision was supported by findings from the phase 3 SORAYA trial (NCT04296890), in which mirvetuximab soravtansine elicited a confirmed investigator-assessed objective response rate (ORR) of 31.7% (95% CI, 22.9%-41.6%); this included a complete response rate of 4.8% and a partial response rate of 26.9%. Moreover, the median duration of response (DOR) was 6.9 months (95% CI, 5.6-9.7) per investigator assessment.

“The approval of Elahere is significant for patients with FRα-positive platinum-resistant ovarian cancer, which is characterized by limited treatment options and poor outcomes,” Ursula Matulonis, MD, chief of the Division of Gynecologic Oncology at the Dana-Farber Cancer Institute, professor of medicine at the Harvard Medical School, and SORAYA co-principal investigator, stated in a press release. “Elahere impressive anti-tumor activity, durability of response, and overall tolerability observed in SORAYA demonstrate the benefit of this new therapeutic option, and I look forward to treating patients with Elahere.”

The global, single-arm SORAYA trial enrolled a total of 106 patients with platinum-resistant ovarian cancer whose tumors expressed high levels of FRα. Patients were allowed to have received up to 3 prior lines of systemic treatment, and all were required to have received bevacizumab (Avastin).

If patients had corneal disorders, ocular conditions in need of ongoing treatment, peripheral neuropathy that was greater than grade 1 in severity, or noninfectious interstitial lung disease, they were excluded.

Study participants received intravenous mirvetuximab soravtansine at 6 mg/kg once every 3 weeks until progressive disease or unacceptable toxicity. Investigators conducted tumor response assessments every 6 weeks for the first 36 weeks, and every 12 weeks thereafter.

Confirmed investigator-assessed ORR served as the primary end point for the research, and the key secondary end point was DOR by RECIST v1.1 criteria.

In the efficacy-evaluable population (n = 104), the median age was 62 years (range, 35-85). Ninety-six percent of patients were White, 2% were Asian, and 2% did not have their race information reported; 2% of patients were Hispanic or Latino. Regarding ECOG performance status, 57% of patients had a status of 0 and the remaining 43% had a status of 1.

Ten percent of patients received 1 prior line of systemic treatment, 39% received 2 prior lines, and 50% received 3 or more prior lines. All patients previously received bevacizumab, as required, and 47% previously received a PARP inhibitor.

The safety of mirvetuximab soravtansine was evaluated in all 106 patients. The median duration of treatment with the agent was 4.2 months (range, 0.7-13.3).

The all-grade toxicities most commonly experienced with mirvetuximab soravtansine included vision impairment (50%), fatigue (49%), increased aspartate aminotransferase (50%), nausea (40%), increased alanine aminotransferase (39%), keratopathy (37%), abdominal pain (36%), decreased lymphocytes (35%), peripheral neuropathy (33%), diarrhea (31%), decreased albumin (31%), constipation (30%), increased alkaline phosphatase (30%), dry eye (27%), decreased magnesium (27%), decreased leukocytes (26%), decreased neutrophils (26%), and decreased hemoglobin (25%).

Thirty-one percent of patients experienced serious adverse reactions with the agent, which included intestinal obstruction (8%), ascites (4%), infection (3%), and pleural effusion (3%). Toxicities proved to be fatalfor 2% of patients, and these included small intestinal obstruction (1%) and pneumonitis (1%).

Twenty percent of patients required dose reductions due to toxicities. Eleven percent of patients discontinued treatment with mirvetuximab soravtansine because of adverse reactions. Toxicities that resulted in more than 2% of patients discontinuing treatment included intestinal obstruction (2%) and thrombocytopenia (2%). One patient discontinued because of visual impairment.

References

  1. ImmunoGen announces FDA accelered approval of Elahere (mirvetuximab soravtansine-gynx) for the treatment of platinum-resistant ovarian cancer. News release. ImmunoGen Inc. November 14, 2022. Accessed November 14, 2022. http://bit.ly/3GgrCwL
  2. FDA grants accelerated approval to mirvetuximab soravtansine-gynx for FRα positive, platinum-resistant epithelial ovarian, fallopian tube, or peritoneal cancer. News release. FDA. November 14, 2022. Accessed November 14, 2022. http://bit.ly/3UP742w
  3. Elahere (mirvetuximab soravtansine-gynx). Prescribing information; ImmunoGen Inc; 2022. Accessed November 14, 2022. https://www.accessdata.fda.gov/drugsatfda_docs/label/2022/761310s000lbl.pdf
wdt-2

NEW DRUG APPROVALS

ONE TIME

$10.00

////////

str1
Flag Counter

AS ON DEC2021 3,491,869 VIEWS ON BLOG WORLDREACH AVAILABLEFOR YOUR ADVERTISEMENT

wdt-16

join me on Linkedin

Anthony Melvin Crasto Ph.D – India | LinkedIn

join me on Researchgate

RESEARCHGATE

This image has an empty alt attribute; its file name is research.jpg

join me on Facebook

Anthony Melvin Crasto Dr. | Facebook

join me on twitter

Anthony Melvin Crasto Dr. | twitter

+919321316780 call whatsaapp

EMAIL. amcrasto@amcrasto

/////////////////////////////////////////////////////////////////////////////

//////////Mirvetuximab soravtansine-gynx, FDA 2022, APPROVALS 2022,  recurrent ovarian cancer, 

Elahere

Tremelimumab


(Light chain)
DIQMTQSPSS LSASVGDRVT ITCRASQSIN SYLDWYQQKP GKAPKLLIYA ASSLQSGVPS
RFSGSGSGTD FTLTISSLQP EDFATYYCQQ YYSTPFTFGP GTKVEIKRTV AAPSVFIFPP
SDEQLKSGTA SVVCLLNNFY PREAKVQWKV DNALQSGNSQ ESVTEQDSKD STYSLSSTLT
LSKADYEKHK VYACEVTHQG LSSPVTKSFN RGEC
(Heavy chain)
QVQLVESGGG VVQPGRSLRL SCAASGFTFS SYGMHWVRQA PGKGLEWVAV IWYDGSNKYY
ADSVKGRFTI SRDNSKNTLY LQMNSLRAED TAVYYCARDP RGATLYYYYY GMDVWGQGTT
VTVSSASTKG PSVFPLAPCS RSTSESTAAL GCLVKDYFPE PVTVSWNSGA LTSGVHTFPA
VLQSSGLYSL SSVVTVPSSN FGTQTYTCNV DHKPSNTKVD KTVERKCCVE CPPCPAPPVA
GPSVFLFPPK PKDTLMISRT PEVTCVVVDV SHEDPEVQFN WYVDGVEVHN AKTKPREEQF
NSTFRVVSVL TVVHQDWLNG KEYKCKVSNK GLPAPIEKTI SKTKGQPREP QVYTLPPSRE
EMTKNQVSLT CLVKGFYPSD IAVEWESNGQ PENNYKTTPP MLDSDGSFFL YSKLTVDKSR
WQQGNVFSCS VMHEALHNHY TQKSLSLSPG K
(Disulfide bridge: L23-L88, L134-L194, L214-H139, H22-H96, H152-H208, H265-H325, H371-H429, H227-H’227, H228-H’228, H231-H’231, H234-H’234)

Tremelimumab 5GGV.png

Fab fragment of tremelimumab (blue) binding CTLA-4 (green). From PDB entry 5GGV.

Tremelimumab

FormulaC6500H9974N1726O2026S52
CAS745013-59-6
Mol weight146380.4722

FDA APPROVED2022/10/21, Imjudo

PEPTIDE, CP 675206

Antineoplastic, Immune checkpoint inhibitor, Anti-CTLA4 antibody
  DiseaseHepatocellular carcinoma

Tremelimumab (formerly ticilimumabCP-675,206) is a fully human monoclonal antibody against CTLA-4. It is an immune checkpoint blocker. Previously in development by Pfizer,[1] it is now in investigation by MedImmune, a wholly owned subsidiary of AstraZeneca.[2] It has been undergoing human trials for the treatment of various cancers but has not attained approval for any.

Imjudo (tremelimumab) in combination with Imfinzi approved in the US for patients with unresectable liver cancer

PUBLISHED24 October 2022

https://www.astrazeneca.com/media-centre/press-releases/2022/imfinzi-and-imjudo-approved-in-advanced-liver-cancer.html

24 October 2022 07:00 BST
 

Approval based on HIMALAYA Phase III trial results which showed single priming dose of Imjudo added to Imfinzi reduced risk of death by 22% vs. sorafenib
 

AstraZeneca’s Imjudo (tremelimumab) in combination with Imfinzi (durvalumab) has been approved in the US for the treatment of adult patients with unresectable hepatocellular carcinoma (HCC), the most common type of liver cancer. The novel dose and schedule of the combination, which includes a single dose of the anti-CTLA-4 antibody Imjudo 300mg added to the anti-PD-L1 antibody Imfinzi 1500mg followed by Imfinzi every four weeks, is called the STRIDE regimen (Single Tremelimumab Regular Interval Durvalumab).

The approval by the US Food and Drug Administration (FDA) was based on positive results from the HIMALAYA Phase III trial. In this trial, patients treated with the combination of Imjudo and Imfinzi experienced a 22% reduction in the risk of death versus sorafenib (based on a hazard ratio [HR] of 0.78, 95% confidence interval [CI] 0.66-0.92 p=0.0035).1 Results were also published in the New England Journal of Medicine Evidence showing that an estimated 31% of patients treated with the combination were still alive after three years, with 20% of patients treated with sorafenib still alive at the same duration of follow-up.2

Liver cancer is the third-leading cause of cancer death and the sixth most commonly diagnosed cancer worldwide.3,4 It is the fastest rising cause of cancer-related deaths in the US, with approximately 36,000 new diagnoses each year.5,6

Ghassan Abou-Alfa, MD, MBA, Attending Physician at Memorial Sloan Kettering Cancer Center (MSK), and principal investigator in the HIMALAYA Phase III trial, said: “Patients with unresectable liver cancer are in need of well-tolerated treatments that can meaningfully extend overall survival. In addition to this regimen demonstrating a favourable three-year survival rate in the HIMALAYA trial, safety data showed no increase in severe liver toxicity or bleeding risk for the combination, important factors for patients with liver cancer who also have advanced liver disease.”

Dave Fredrickson, Executive Vice President, Oncology Business Unit, AstraZeneca, said: “With this first regulatory approval for Imjudo, patients with unresectable liver cancer in the US now have an approved dual immunotherapy treatment regimen that harnesses the potential of CTLA-4 inhibition in a unique combination with a PD-L1 inhibitor to enhance the immune response against their cancer.”

Andrea Wilson Woods, President & Founder, Blue Faery: The Adrienne Wilson Liver Cancer Foundation, said: “In the past, patients living with liver cancer had few treatment options and faced poor prognoses. With today’s approval, we are grateful and optimistic for new, innovative, therapeutic options. These new treatments can improve long-term survival for those living with unresectable hepatocellular carcinoma, the most common form of liver cancer. We appreciate the patients, their families, and the broader liver cancer community who continue to fight for new treatments and advocate for others.”

The safety profiles of the combination of Imjudo added to Imfinzi and for Imfinzi alone were consistent with the known profiles of each medicine, and no new safety signals were identified.

Regulatory applications for Imjudo in combination with Imfinzi are currently under review in Europe, Japan and several other countries for the treatment of patients with advanced liver cancer based on the HIMALAYA results.

Notes

Liver cancer
About 75% of all primary liver cancers in adults are HCC.3 Between 80-90% of all patients with HCC also have cirrhosis.Chronic liver diseases are associated with inflammation that over time can lead to the development of HCC.7

More than half of patients are diagnosed at advanced stages of the disease, often when symptoms first appear.8 A critical unmet need exists for patients with HCC who face limited treatment options.8 The unique immune environment of liver cancer provides clear rationale for investigating medications that harness the power of the immune system to treat HCC.8

HIMALAYA
HIMALAYA was a randomised, open-label, multicentre, global Phase III trial of Imfinzi monotherapy and a regimen comprising a single priming dose of Imjudo 300mg added to Imfinzi 1500mg followed by Imfinzi every four weeks versus sorafenib, a standard-of-care multi-kinase inhibitor.

The trial included a total of 1,324 patients with unresectable, advanced HCC who had not been treated with prior systemic therapy and were not eligible for locoregional therapy (treatment localised to the liver and surrounding tissue).

The trial was conducted in 181 centres across 16 countries, including in the US, Canada, Europe, South America and Asia. The primary endpoint was overall survival (OS) for the combination versus sorafenib and key secondary endpoints included OS for Imfinzi versus sorafenib, objective response rate and progression-free survival (PFS) for the combination and for Imfinzi alone.

Imfinzi
Imfinzi (durvalumab) is a human monoclonal antibody that binds to the PD-L1 protein and blocks the interaction of PD-L1 with the PD-1 and CD80 proteins, countering the tumour’s immune-evading tactics and releasing the inhibition of immune responses.

Imfinzi was recently approved to treat patients with advanced biliary tract cancer in the US based on results from the TOPAZ-1 Phase III trial. It is the only approved immunotherapy in the curative-intent setting of unresectable, Stage III non-small cell lung cancer (NSCLC) in patients whose disease has not progressed after chemoradiotherapy and is the global standard of care in this setting based on the PACIFIC Phase III trial.

Imfinzi is also approved in the US, EU, Japan, China and many other countries around the world for the treatment of extensive-stage small cell lung cancer (ES-SCLC) based on the CASPIAN Phase III trial. In 2021, updated results from the CASPIAN trial showed Imfinzi plus chemotherapy tripled patient survival at three years versus chemotherapy alone.

Imfinzi is also approved for previously treated patients with advanced bladder cancer in several countries.

Since the first approval in May 2017, more than 100,000 patients have been treated with Imfinzi.

As part of a broad development programme, Imfinzi is being tested as a single treatment and in combinations with other anti-cancer treatments for patients with SCLC, NSCLC, bladder cancer, several gastrointestinal (GI) cancers, ovarian cancer, endometrial cancer, and other solid tumours.

Imfinzi combinations have also demonstrated clinical benefit in metastatic NSCLC in the POSEIDON Phase III trial.

Imjudo
Imjudo (tremelimumab) is a human monoclonal antibody that targets the activity of cytotoxic T-lymphocyte-associated protein 4 (CTLA-4). Imjudo blocks the activity of CTLA-4, contributing to T-cell activation, priming the immune response to cancer and fostering cancer cell death.

Beyond HIMALAYA, Imjudo is being tested in combination with Imfinzi across multiple tumour types including locoregional HCC (EMERALD-3), SCLC (ADRIATIC) and bladder cancer (VOLGA and NILE).

Imjudo is also under review by global regulatory authorities in combination with Imfinzi and chemotherapy in 1st-line metastatic NSCLC based on the results of the POSEIDON Phase III trial, which showed the addition of a short course of Imjudo to Imfinzi plus chemotherapy improved both overall and progression-free survival compared to chemotherapy alone.

AstraZeneca in GI cancers
AstraZeneca has a broad development programme for the treatment of GI cancers across several medicines spanning a variety of tumour types and stages of disease. In 2020, GI cancers collectively represented approximately 5.1 million new diagnoses leading to approximately 3.6 million deaths.9

Within this programme, the Company is committed to improving outcomes in gastric, liver, biliary tract, oesophageal, pancreatic, and colorectal cancers.

Imfinzi (durvalumab) is being assessed in combinations in oesophageal and gastric cancers in an extensive development programme spanning early to late-stage disease across settings.

The Company aims to understand the potential of Enhertu (trastuzumab deruxtecan), a HER2-directed antibody drug conjugate, in the two most common GI cancers, colorectal and gastric cancers. Enhertu is jointly developed and commercialised by AstraZeneca and Daiichi Sankyo.

Lynparza (olaparib) is a first-in-class PARP inhibitor with a broad and advanced clinical trial programme across multiple GI tumour types including pancreatic and colorectal cancers. Lynparza is developed and commercialised in collaboration with MSD (Merck & Co., Inc. inside the US and Canada).

AstraZeneca in immuno-oncology (IO)
Immunotherapy is a therapeutic approach designed to stimulate the body’s immune system to attack tumours. The Company’s immuno-oncology (IO) portfolio is anchored in immunotherapies that have been designed to overcome evasion of the anti-tumour immune response. AstraZeneca is invested in using IO approaches that deliver long-term survival for new groups of patients across tumour types.

The Company is pursuing a comprehensive clinical trial programme that includes Imfinzi as a single treatment and in combination with Imjudo (tremelimumab) and other novel antibodies in multiple tumour types, stages of disease, and lines of treatment, and where relevant using the PD-L1 biomarker as a decision-making tool to define the best potential treatment path for a patient.

In addition, the ability to combine the IO portfolio with radiation, chemotherapy, and targeted small molecules from across AstraZeneca’s oncology pipeline, and from research partners, may provide new treatment options across a broad range of tumours.

AstraZeneca in oncology
AstraZeneca is leading a revolution in oncology with the ambition to provide cures for cancer in every form, following the science to understand cancer and all its complexities to discover, develop and deliver life-changing medicines to patients.

The Company’s focus is on some of the most challenging cancers. It is through persistent innovation that AstraZeneca has built one of the most diverse portfolios and pipelines in the industry, with the potential to catalyse changes in the practice of medicine and transform the patient experience.

AstraZeneca has the vision to redefine cancer care and, one day, eliminate cancer as a cause of death.

////////

str1
Flag Counter

AS ON DEC2021 3,491,869 VIEWS ON BLOG WORLDREACH AVAILABLEFOR YOUR ADVERTISEMENT

wdt-16

join me on Linkedin

Anthony Melvin Crasto Ph.D – India | LinkedIn

join me on Researchgate

RESEARCHGATE

This image has an empty alt attribute; its file name is research.jpg

join me on Facebook

Anthony Melvin Crasto Dr. | Facebook

join me on twitter

Anthony Melvin Crasto Dr. | twitter

+919321316780 call whatsaapp

EMAIL. amcrasto@amcrasto

/////////////////////////////////////////////////////////////////////////////

Mechanism of action

Tremelimumab aims to stimulate an immune system attack on tumors. Cytotoxic T lymphocytes (CTLs) can recognize and destroy cancer cells. However, there is also an inhibitory mechanism (immune checkpoint) that interrupts this destruction. Tremelimumab turns off this inhibitory mechanism and allows CTLs to continue to destroy the cancer cells.[3] This is immune checkpoint blockade.

Tremelimumab binds to the protein CTLA-4, which is expressed on the surface of activated T lymphocytes and inhibits the killing of cancer cells. Tremelimumab blocks the binding of the antigen-presenting cell ligands B7.1 and B7.2 to CTLA-4, resulting in inhibition of B7-CTLA-4-mediated downregulation of T-cell activation; subsequently, B7.1 or B7.2 may interact with another T-cell surface receptor protein, CD28, resulting in a B7-CD28-mediated T-cell activation unopposed by B7-CTLA-4-mediated inhibition.

Unlike Ipilimumab (another fully human anti-CTLA-4 monoclonal antibody), which is an IgG1 isotype, tremelimumab is an IgG2 isotype.[4][5]

Clinical trials

Melanoma

Phase 1 and 2 clinical studies in metastatic melanoma showed some responses.[6] However, based on early interim analysis of phase III data, Pfizer designated tremelimumab as a failure and terminated the trial in April 2008.[1][7]

However, within a year, the survival curves showed separation of the treatment and control groups.[8] The conventional Response Evaluation Criteria in Solid Tumors (RECIST) may underrepresent the merits of immunotherapies. Subsequent immunotherapy trials (e.g. ipilimumab) have used the Immune-Related Response Criteria (irRC) instead.

Mesothelioma

Although it was designated in April 2015 as orphan drug status in mesothelioma,[9] tremelimumab failed to improve lifespan in the phase IIb DETERMINE trial, which assessed the drug as a second or third-line treatment for unresectable malignant mesothelioma.[10][11]

Non-small cell lung cancer

In a phase III trial, AstraZeneca paired tremelimumab with a PD-L1 inhibitor, durvalumab, for the first-line treatment of non-small cell lung cancer.[12] The trial was conducted across 17 countries, and in July 2017, AstraZeneca announced that it had failed to meet its primary endpoint of progression-free survival.[13]

References

  1. Jump up to:a b “Pfizer Announces Discontinuation of Phase III Clinical Trial for Patients with Advanced Melanoma”. Pfizer.com. 1 April 2008. Retrieved 5 December 2015.
  2. ^ Mechanism of Pathway: CTLA-4 Inhibition[permanent dead link]
  3. ^ Antoni Ribas (28 June 2012). “Tumor immunotherapy directed at PD-1”. New England Journal of Medicine366 (26): 2517–9. doi:10.1056/nejme1205943PMID 22658126.
  4. ^ Tomillero A, Moral MA (October 2008). “Gateways to clinical trials”. Methods Find Exp Clin Pharmacol30 (8): 643–72. doi:10.1358/mf.2008.30.5.1236622PMID 19088949.
  5. ^ Poust J (December 2008). “Targeting metastatic melanoma”. Am J Health Syst Pharm65 (24 Suppl 9): S9–S15. doi:10.2146/ajhp080461PMID 19052265.
  6. ^ Reuben, JM; et al. (1 Jun 2006). “Biologic and immunomodulatory events after CTLA-4 blockade with tremelimumab in patients with advanced malignant melanoma”Cancer106 (11): 2437–44. doi:10.1002/cncr.21854PMID 16615096S2CID 751366.
  7. ^ A. Ribas, A. Hauschild, R. Kefford, C. J. Punt, J. B. Haanen, M. Marmol, C. Garbe, J. Gomez-Navarro, D. Pavlov and M. Marsha (May 20, 2008). “Phase III, open-label, randomized, comparative study of tremelimumab (CP-675,206) and chemotherapy (temozolomide [TMZ] or dacarbazine [DTIC]) in patients with advanced melanoma”Journal of Clinical Oncology26 (15S): LBA9011. doi:10.1200/jco.2008.26.15_suppl.lba9011.[permanent dead link]
  8. ^ M.A. Marshall, A. Ribas, B. Huang (May 2010). “Evaluation of baseline serum C-reactive protein (CRP) and benefit from tremelimumab compared to chemotherapy in first-line melanoma”Journal of Clinical Oncology28 (15S): 2609. doi:10.1200/jco.2010.28.15_suppl.2609.[permanent dead link]
  9. ^ FDA Grants AstraZeneca’s Tremelimumab Orphan Drug Status for Mesothelioma [1]
  10. ^ “Tremelimumab Fails Mesothelioma Drug Trial”. Archived from the original on 2016-03-06. Retrieved 2016-03-06.
  11. ^ AZ’ tremelimumab fails in mesothelioma trial
  12. ^ “AstraZeneca’s immuno-oncology combo fails crucial Mystic trial in lung cancer | FierceBiotech”.
  13. ^ “AstraZeneca reports initial results from the ongoing MYSTIC trial in Stage IV lung cancer”.

///////////Tremelimumab, Imjudo, APPROVALS 2022, FDA 2022, PEPTIDE, CP 675206, Antineoplastic, Immune checkpoint inhibitor, Anti-CTLA4 antibody

wdt-4

NEW DRUG APPROVALS

ONE TIME

$10.00

Daxibotulinumtoxin A


FDA Approves Botox Challenger Daxxify for Frown Lines

Daxibotulinumtoxin A

FDA APPROVED 2022 2022/9/7, Daxxify

FormulaC6708H10359N1729O1995S32
CAS93384-43-1
Mol weight148171.4934

Daxibotulinumtoxin A-lanm

Treatment of galbellar lines, cervical dystonia, lateral canthal lines, migraine headaches and hyperhidrosis

  • DeveloperRevance Therapeutics; Shanghai Fosun Pharmaceutical
  • ClassAnalgesics; Anti-inflammatories; Antiarrhythmics; Antidepressants; Antimigraines; Antipruritics; Antispasmodics; Bacterial proteins; Bacterial toxins; Botulinum toxins; Eye disorder therapies; Foot disorder therapies; Muscle relaxants; Skin disorder therapies; Urologics; Vascular disorder therapies
  • Mechanism of ActionAcetylcholine inhibitors; Glutamate antagonists; Membrane transport protein modulators; Neuromuscular blocking agents
  • Orphan Drug StatusYes – Torticollis
  • RegisteredGlabellar lines
  • Phase IIITorticollis
  • Phase IIMuscle spasticity
  • No development reportedSkin disorders
  • DiscontinuedPlantar fasciitis
  • 19 Sep 2022Efficacy data from a phase IIa FHL trials in Glabellar-lines (crow’s feet) released by Revance
  • 19 Sep 2022Updated efficacy and safety data from the phase III SAKURA 1, SAKURA 2 and SAKURA 3 trials in Glabellar lines released by Revance Therapeutics
  • 18 Sep 2022Updated efficacy and safety data from the phase III SAKURA 1, SAKURA 2 and SAKURA 3 trials in Glabellar lines released by Revance Therapeutics

////////

str1
Flag Counter

AS ON DEC2021 3,491,869 VIEWS ON BLOG WORLDREACH AVAILABLEFOR YOUR ADVERTISEMENT

wdt-16

join me on Linkedin

Anthony Melvin Crasto Ph.D – India | LinkedIn

join me on Researchgate

RESEARCHGATE

This image has an empty alt attribute; its file name is research.jpg

join me on Facebook

Anthony Melvin Crasto Dr. | Facebook

join me on twitter

Anthony Melvin Crasto Dr. | twitter

+919321316780 call whatsaapp

EMAIL. amcrasto@amcrasto

/////////////////////////////////////////////////////////////////////////////

DAXI Impresses; Approaches FDA Approval

March 2, 2021

Lisette Hilton

Dermatology Times, Dermatology Times, February 2021 (Vol. 42, No. 2), Volume 42, Issue 2

The investigational neuromodulator, evaluated in clinical trials as a treatment for glabellar lines and as a combined therapy for glabellar, dynamic forehead, and lateral canthal lines, is quickly nearing an approval by the FDA.

The long-awaited, longer-lasting neuromodulator drug candidate DaxibotulinumtoxinA for Injection (DAXI), a botulinum toxin type A formulated with a novel peptide excipient, may be nearing FDA approval.

In mid-December 2020, Revance Therapeutics shared results from its phase 2 upper facial lines study (NCT04259086),1 in which investigators looked at DAXI for combined treatment of glabellar, dynamic forehead, and lateral canthal lines.

The authors reported on a multicenter study of 48 patients enrolled to receive 40, 32, and 48 U of DAXI for injection in the glabellar complex, forehead, and lateral canthal areas, respectively. At week 4, nearly 92% of patients achieved an Investigator Global Assessment (IGA) score indicating no or mild wrinkle severity with maximum contraction on their lateral canthal lines. Nearly 96% achieved similar results on their forehead and glabellar lines at week 4.

Wrinkle severity returned to baseline at a median of 7.6 months post treatment, according to the phase 2 study findings.

The treatment was well tolerated in all upper facial regions. The most common adverse event (AE) was injection site erythema, which occurred in 6.3% of patients. The authors reported no eyelid or brow ptosis.

This was Revance’s first DAXI study on not just glabellar lines but also on forehead and periocular lines, or crow’s-feet, according to Jeffrey S. Dover, MD, FRCPC, a phase 2 study investigator and a dermatologist at SkinCare Physicians in Chestnut Hill, Massachusetts. “I think this is yet more evidence that the Revance neuromodulator produces an impressive effect on lines of negative facial expression and lasts longer than any of the other neuromodulators approved by the FDA thus far,” said Dover.

Dermatologic Surgery published 2 papers on the investigational neuromodulator in January 2021. In one study,2 investigators evaluated the use of up to 3 DAXI treatments for moderate or severe glabellar lines. They focused on data from SAKURA 1 and 2 (NCT03014622 and NCT03014635), two identical phase 3, open label, multicenter studies in which investigators evaluated single and repeat treatment of the glabellar lines with 40 U of DAXI.

The authors reported on safety results for nearly 2700 patients, including 882 who received a second treatment and 568 who got DAXI a third time. Treatment-related AEs, which were generally mild and resolved, occurred in 17.8% of patients. Eyelid ptosis occurred in 0.9% of treatments.

Investigators of 2 other studies3,4 focused on DAXI efficacy among nearly 2700 subjects enrolled in Revance’s preceding pivotal trials. Participants received repeat treatments when they returned to baseline on the IGA–Frown Wrinkle Severity (FWS) and IGA–Patient Frown Winkle Severity (PFWS) scales at 12 weeks and up to 36 weeks after treatment.

More than 96% of patients achieved no or mild severity in glabellar wrinkles on the IGA- FWS scale after each of the 3 treatments, with peak responses between weeks 2 to 4, and about one-third or more saw no or mild severity at week 24. Response rates reached highs of 92% or more at weeks 2 to 4 on the IGA-PFWS scale.

“The median duration for return to moderate or severe severity was 24 weeks,” the authors said. “If approved, I believe daxibotulinumtoxinA will change the landscape of neuromodulators significantly. The approved ones all last 3 months. They all give nice results and have few adverse effects,” Dover said.

He and other investigators have seen no rise in AEs, and those that did occur lasted no longer than those of Botox, he said.

Revance appears to be preparing for approval. The company announced on December 22, 2020, that it has a strategic commercial manufacturing agreement with Ajinomoto Bio- Pharma Services for the supply of DAXI.5

As of November 24, 2020, the FDA had deferred a decision on the neuromodulator because the required factory inspection could not be conducted due to travel restrictions related to coronavirus disease 2019.6 The FDA did not indicate any other issues.

References:

  1. Green JB, Mariwalla K, Coleman K, et al. A large, open-label, phase 3 safety study of DaxibotulinumtoxinA for Injection in glabellar lines: a focus on safety from the SAKURA 3 study. Derm Surg. 2021;47(1):42-46. doi:10.1097/DSS.0000000000002463
  2. Carruthers JD, Jean D, Fagien S, et al; SAKURA 1 and SAKURA 2 Investigator Group. DaxibotulinumtoxinA for Injection for the treatment of glabellar lines: results from each of two multicenter, randomized, double-blind, placebo-controlled, phase 3 studies (SAKURA 1 and SAKURA 2).Plast Reconstr Surg. 2020;1(145):45-58.doi: 10.1097/PRS.0000000000006327
  3. Fabi SG, Cohen JL, Green LJ, et al. DaxibotulinumtoxinA for Injection for the treatment of glabellar lines: efficacy results from SAKURA 3, a large, open-label, phase 3 safety study. Derm Surg. 2021;47(1):48-54. doi:10.1097/DSS.0000000000002531
  4. https://investors.revance.com/news-releases/news-release-details/ajinomoto-bio-pharma-services-and-revance-therapeutics-announce. December 22, 2020. Accessed January 15, 2021.
  5. FDA defers approval of DaxibotulinumtoxinA for Injection in glabellar lines due to COVID-19 related travel restrictions impacting manufacturing site inspection. News release. Revance Therapeutics, Inc. November 25, 2020. Accessed January 13, 2021. https://www.businesswire.com/news/home/20201125005462/en/FDA-Defers-Approval-DaxibotulinumtoxinA-Injection-Glabellar-Lines

///////////Daxibotulinumtoxin A, FDA 2022, APPROVALS 2022, DAXI, Daxibotulinumtoxin-A, DaxibotulinumtoxinA for Injection, daxibotulinumtoxinA-lanm, DAXXIFY, RT-002, Orphan Drug

wdt-3

NEW DRUG APPROVALS

ONE TIME

$10.00